BLASTX nr result
ID: Mentha28_contig00024020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00024020 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006434434.1| hypothetical protein CICLE_v10003619mg [Citr... 57 3e-06 ref|XP_004290543.1| PREDICTED: serine/threonine-protein kinase H... 57 3e-06 >ref|XP_006434434.1| hypothetical protein CICLE_v10003619mg [Citrus clementina] gi|557536556|gb|ESR47674.1| hypothetical protein CICLE_v10003619mg [Citrus clementina] Length = 550 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +3 Query: 3 LSLMQKCWDALPSNRPSFSEIRIELEALQQEVNDAPNGS 119 + LMQ+CWDA+P NRPSFSEI++ELE L QEV + P+G+ Sbjct: 509 IDLMQRCWDAVPDNRPSFSEIKLELEVLLQEVQE-PSGA 546 >ref|XP_004290543.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria vesca subsp. vesca] Length = 541 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/42 (61%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = +3 Query: 3 LSLMQKCWDALPSNRPSFSEIRIELEALQQEV---NDAPNGS 119 L LMQ+CWDA+PSNRP+FS+I +ELE L QEV ++A NG+ Sbjct: 500 LELMQRCWDAVPSNRPAFSDIAVELETLAQEVQGNSEAANGT 541