BLASTX nr result
ID: Mentha28_contig00023757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023757 (749 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44304.1| hypothetical protein MIMGU_mgv1a007475mg [Mimulus... 74 7e-11 gb|EYU39376.1| hypothetical protein MIMGU_mgv1a019801mg [Mimulus... 64 4e-08 >gb|EYU44304.1| hypothetical protein MIMGU_mgv1a007475mg [Mimulus guttatus] Length = 406 Score = 73.6 bits (179), Expect = 7e-11 Identities = 37/47 (78%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = -3 Query: 747 DSFIKTIQELRDRANKCTQETRMARTLILRKIINHPTSS--DIGMFS 613 DSF+KTI +L ANKCTQETRMARTLILRKIINHP+ S DIGMFS Sbjct: 360 DSFVKTIHDLSKHANKCTQETRMARTLILRKIINHPSGSNQDIGMFS 406 >gb|EYU39376.1| hypothetical protein MIMGU_mgv1a019801mg [Mimulus guttatus] Length = 418 Score = 64.3 bits (155), Expect = 4e-08 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = -3 Query: 741 FIKTIQELRDRANKCTQETRMARTLILRKIINHP---TSSDIGMFS 613 FIKTI +L + ANKC+ ETRMARTLILR+IINHP ++ D+GMFS Sbjct: 373 FIKTIHDLSEHANKCSHETRMARTLILRRIINHPKNDSNRDVGMFS 418