BLASTX nr result
ID: Mentha28_contig00023715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023715 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45184.1| hypothetical protein MIMGU_mgv1a0003262mg, partia... 105 5e-21 gb|EPS69788.1| hypothetical protein M569_04979, partial [Genlise... 69 7e-10 >gb|EYU45184.1| hypothetical protein MIMGU_mgv1a0003262mg, partial [Mimulus guttatus] Length = 96 Score = 105 bits (263), Expect = 5e-21 Identities = 50/68 (73%), Positives = 61/68 (89%) Frame = -2 Query: 205 FSSSFSFKNPYGDVMLSNGGERKSLQLHEYSEIFSGSSSIPVLDLSTMDERVGSADFQSS 26 FSS+FSFKNPY V+L +GGERKSL+ HEY EIFSGSS+IPVLDLS +D+RVGSAD +SS Sbjct: 20 FSSTFSFKNPYDGVLLPSGGERKSLEAHEYREIFSGSSAIPVLDLSGLDDRVGSADPRSS 79 Query: 25 KLDYANIF 2 K+DY+N+F Sbjct: 80 KIDYSNLF 87 >gb|EPS69788.1| hypothetical protein M569_04979, partial [Genlisea aurea] Length = 73 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/58 (58%), Positives = 44/58 (75%), Gaps = 3/58 (5%) Frame = -2 Query: 202 SSSFSFKNPYGDVMLSNGGER---KSLQLHEYSEIFSGSSSIPVLDLSTMDERVGSAD 38 S+ S+KNPY DV+LSNGG R K + +Y+EIF+GSSSIPV DLS +D+RVGS + Sbjct: 16 SNGISWKNPYEDVVLSNGGGRGKGKVFEARDYAEIFAGSSSIPVFDLSALDDRVGSGE 73