BLASTX nr result
ID: Mentha28_contig00023588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023588 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39688.1| hypothetical protein MIMGU_mgv1a020647mg [Mimulus... 55 8e-06 >gb|EYU39688.1| hypothetical protein MIMGU_mgv1a020647mg [Mimulus guttatus] Length = 100 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/92 (40%), Positives = 43/92 (46%), Gaps = 2/92 (2%) Frame = +1 Query: 52 MSADLEL--RLPIIKMAAAPRXXXXXXXXXXXXCVSEEECRTPRSPEHMIPAVLXXXXXX 225 MS DLEL +LPIIK+ + P+ EE C TPRSP+HMIP + Sbjct: 1 MSTDLELFRQLPIIKINSTPQKSDITTDKEEK---EEENCHTPRSPKHMIPTAV-SCPPA 56 Query: 226 XXXXXXXXXXXXXLCELDFFEVVAENEIESFF 321 LCEL FFE V EIES F Sbjct: 57 PKKRRPAAACKRKLCELQFFEFVGREEIESLF 88