BLASTX nr result
ID: Mentha28_contig00023233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023233 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006420327.1| hypothetical protein CICLE_v10006723mg [Citr... 58 2e-06 ref|XP_006342683.1| PREDICTED: peroxygenase-like [Solanum tubero... 57 4e-06 ref|XP_006294908.1| hypothetical protein CARUB_v10023959mg [Caps... 55 8e-06 >ref|XP_006420327.1| hypothetical protein CICLE_v10006723mg [Citrus clementina] gi|557522200|gb|ESR33567.1| hypothetical protein CICLE_v10006723mg [Citrus clementina] Length = 241 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -2 Query: 359 AKDREGLLSKEAVRGCFDGSLFEYCARMQAQNEHK 255 A+D EGLLSKEAVR CFDGSLFEYCARM E K Sbjct: 205 ARDEEGLLSKEAVRRCFDGSLFEYCARMNLVGEDK 239 >ref|XP_006342683.1| PREDICTED: peroxygenase-like [Solanum tuberosum] Length = 243 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -2 Query: 359 AKDREGLLSKEAVRGCFDGSLFEYCARMQAQNE 261 A+D++G LSKEA+R CFDGSLFEYCA++Q +NE Sbjct: 205 ARDQDGFLSKEAIRRCFDGSLFEYCAKIQMENE 237 >ref|XP_006294908.1| hypothetical protein CARUB_v10023959mg [Capsella rubella] gi|482563616|gb|EOA27806.1| hypothetical protein CARUB_v10023959mg [Capsella rubella] Length = 239 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = -2 Query: 359 AKDREGLLSKEAVRGCFDGSLFEYCARMQAQ--NEHKTD 249 AKD EG +SKEAVRGCFDGSLFEYCA+ + N K D Sbjct: 201 AKDEEGFISKEAVRGCFDGSLFEYCAKKNEERANSRKQD 239