BLASTX nr result
ID: Mentha28_contig00023225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023225 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobrom... 60 2e-07 >ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobroma cacao] gi|508699438|gb|EOX91334.1| Uncharacterized protein TCM_000563 [Theobroma cacao] Length = 51 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/32 (71%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -3 Query: 361 DDEQDKAIDQCCNWCYDCTDTCFDYLFC-DLC 269 +DEQDKA+D+CC+ CYDCT+TCFDYL C +LC Sbjct: 20 EDEQDKAVDECCSCCYDCTETCFDYLCCFNLC 51