BLASTX nr result
ID: Mentha28_contig00023137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023137 (641 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318516.1| hypothetical protein POPTR_0012s04380g [Popu... 71 2e-10 gb|ACJ49159.1| protection of telomeres 1 protein [Populus tricho... 71 2e-10 gb|EYU24148.1| hypothetical protein MIMGU_mgv1a005983mg [Mimulus... 68 2e-09 ref|XP_007036814.1| Protection of telomeres 1 protein isoform 3 ... 66 8e-09 ref|XP_007036812.1| Protection of telomeres 1 protein isoform 1 ... 66 8e-09 ref|XP_004233140.1| PREDICTED: protection of telomeres protein 1... 63 9e-08 ref|XP_002530479.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 ref|XP_006352984.1| PREDICTED: protection of telomeres protein 1... 62 2e-07 ref|NP_001275249.1| protection of telomeres 1 protein [Solanum t... 62 2e-07 gb|ACH57392.1| putative single-strand telomere binding protein [... 59 1e-06 gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana taba... 59 1e-06 ref|XP_002519330.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 gb|EXB80320.1| Protection of telomeres protein 1 [Morus notabilis] 57 5e-06 ref|XP_004137504.1| PREDICTED: protection of telomeres protein 1... 57 5e-06 >ref|XP_002318516.1| hypothetical protein POPTR_0012s04380g [Populus trichocarpa] gi|222859189|gb|EEE96736.1| hypothetical protein POPTR_0012s04380g [Populus trichocarpa] Length = 412 Score = 71.2 bits (173), Expect = 2e-10 Identities = 41/93 (44%), Positives = 60/93 (64%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +AIS +++ VNLIGV + P T GTDFF S+KIVDES P+ G ++FF Sbjct: 8 KFLKIKDAISAINQKVNLIGVVIELGFPKTTRGTDFFCSVKIVDESYPKPGIPVNFFMAH 67 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 +ENLP+V + GDI+ +S +K + ++ FN Sbjct: 68 MENLPTVGSPGDIIQLSRVVMKTHNDGVYALFN 100 >gb|ACJ49159.1| protection of telomeres 1 protein [Populus trichocarpa] Length = 462 Score = 71.2 bits (173), Expect = 2e-10 Identities = 41/93 (44%), Positives = 60/93 (64%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +AIS +++ VNLIGV + P T GTDFF S+KIVDES P+ G ++FF Sbjct: 8 KFLKIKDAISAINQKVNLIGVVIELGFPKTTRGTDFFCSVKIVDESYPKPGIPVNFFMAH 67 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 +ENLP+V + GDI+ +S +K + ++ FN Sbjct: 68 MENLPTVGSPGDIIQLSRVVMKTHNDGVYALFN 100 >gb|EYU24148.1| hypothetical protein MIMGU_mgv1a005983mg [Mimulus guttatus] Length = 462 Score = 68.2 bits (165), Expect = 2e-09 Identities = 36/81 (44%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPRGFYLHFFANPV 270 KF+ +A + +++ VNLIGV V TS P ++ G+D F S+KI+DES P GF++ FFA Sbjct: 7 KFLQIKDATACINQQVNLIGVVVETSAPKQSRGSDLFCSVKIIDESWPLGFHIKFFAETR 66 Query: 269 ENLPSVKN-GDIVLVSNFKVK 210 LP V GDI++V++ V+ Sbjct: 67 AKLPYVDTLGDIIIVTHVVVQ 87 >ref|XP_007036814.1| Protection of telomeres 1 protein isoform 3 [Theobroma cacao] gi|508774059|gb|EOY21315.1| Protection of telomeres 1 protein isoform 3 [Theobroma cacao] Length = 456 Score = 66.2 bits (160), Expect = 8e-09 Identities = 37/93 (39%), Positives = 58/93 (62%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +AI+ +++ VNLIG + S P KT GTD+F +KI+DES P+ G +H FA Sbjct: 5 KFLKIEDAIACINQKVNLIGAILDFSVPQKTKGTDYFCKLKIIDESHPKCGIPVHLFAQH 64 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 ++ LP V + GDI+ +S +K + ++ FN Sbjct: 65 MDALPQVASIGDIIHLSRVMMKTHEGDVYAIFN 97 >ref|XP_007036812.1| Protection of telomeres 1 protein isoform 1 [Theobroma cacao] gi|590665703|ref|XP_007036813.1| Protection of telomeres 1 protein isoform 1 [Theobroma cacao] gi|508774057|gb|EOY21313.1| Protection of telomeres 1 protein isoform 1 [Theobroma cacao] gi|508774058|gb|EOY21314.1| Protection of telomeres 1 protein isoform 1 [Theobroma cacao] Length = 455 Score = 66.2 bits (160), Expect = 8e-09 Identities = 37/93 (39%), Positives = 58/93 (62%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +AI+ +++ VNLIG + S P KT GTD+F +KI+DES P+ G +H FA Sbjct: 5 KFLKIEDAIACINQKVNLIGAILDFSVPQKTKGTDYFCKLKIIDESHPKCGIPVHLFAQH 64 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 ++ LP V + GDI+ +S +K + ++ FN Sbjct: 65 MDALPQVASIGDIIHLSRVMMKTHEGDVYAIFN 97 >ref|XP_004233140.1| PREDICTED: protection of telomeres protein 1b-like [Solanum lycopersicum] Length = 466 Score = 62.8 bits (151), Expect = 9e-08 Identities = 38/93 (40%), Positives = 56/93 (60%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +A + + + VNLIGV V T P K+ GTD F SI+I+DES P G ++FFA Sbjct: 11 KFLQIVDARAALGQKVNLIGVVVETGLPKKSRGTDVFCSIRIIDESYPSPGIAVNFFAET 70 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 ++ LP V GDI+ +S +K + ++ FN Sbjct: 71 MDKLPEVLTVGDILQISQVVMKTHGPDIYALFN 103 >ref|XP_002530479.1| conserved hypothetical protein [Ricinus communis] gi|223529976|gb|EEF31902.1| conserved hypothetical protein [Ricinus communis] Length = 449 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 2/82 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 K++ +AIS +++ V+LIG+ + P KT GTD+F ++KIVDES P+ G ++ FA+ Sbjct: 5 KYLELKDAISSINQKVSLIGIILEFGLPKKTRGTDWFCTVKIVDESYPKPGISINIFASS 64 Query: 272 VENLPSVKN-GDIVLVSNFKVK 210 +E LP V + GDI+ +S+ +K Sbjct: 65 IEKLPRVLSLGDIIQLSHVVMK 86 >ref|XP_006352984.1| PREDICTED: protection of telomeres protein 1b isoform X2 [Solanum tuberosum] Length = 406 Score = 61.6 bits (148), Expect = 2e-07 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +A + + + VNLIGV + T P ++ GTD F SI+I+DES P G ++FFA Sbjct: 11 KFLQIVDARAALGQKVNLIGVVIETGLPKQSKGTDCFCSIRIIDESYPSPGIAVNFFAET 70 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 ++ LP V GDI+ +S +K + ++ FN Sbjct: 71 MDKLPEVLTVGDIIQISQVVMKTHGPDIYALFN 103 >ref|NP_001275249.1| protection of telomeres 1 protein [Solanum tuberosum] gi|213495898|gb|ACJ49169.1| protection of telomeres 1 protein [Solanum tuberosum] Length = 466 Score = 61.6 bits (148), Expect = 2e-07 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANP 273 KF+ +A + + + VNLIGV + T P ++ GTD F SI+I+DES P G ++FFA Sbjct: 11 KFLQIVDARAALGQKVNLIGVVIETGLPKQSKGTDCFCSIRIIDESYPSPGIAVNFFAET 70 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 ++ LP V GDI+ +S +K + ++ FN Sbjct: 71 MDKLPEVLTVGDIIQISQVVMKTHGPDIYALFN 103 >gb|ACH57392.1| putative single-strand telomere binding protein [Carica papaya] Length = 463 Score = 59.3 bits (142), Expect = 1e-06 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 2/92 (2%) Frame = -1 Query: 446 FIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANPV 270 F+ +A + +++ VNLIGV V P KT GTD F +KIVDES P+ G +++ FA + Sbjct: 8 FMKIRDATTAINQKVNLIGVVVEFGFPKKTSGTDCFCKLKIVDESHPKAGIWVNVFAPTM 67 Query: 269 ENLPSV-KNGDIVLVSNFKVK*NTFSLFYFFN 177 E LP V GDI+ +S +K ++ FN Sbjct: 68 EMLPHVGLAGDIIQLSRVMMKTFKQEIYAVFN 99 >gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana tabacum] Length = 466 Score = 58.9 bits (141), Expect = 1e-06 Identities = 39/102 (38%), Positives = 61/102 (59%), Gaps = 3/102 (2%) Frame = -1 Query: 473 GCKMSGRN-KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-G 300 G + SG + KF+ +A + +++ V LIGV + T P ++ GTD F +IKI+DES P G Sbjct: 2 GRRSSGDDYKFLQIVDARAALNQKVYLIGVVIETGLPKQSKGTDCFCTIKIIDESYPSPG 61 Query: 299 FYLHFFANPVENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 ++FFA ++ LP V GDIV +S +K + ++ FN Sbjct: 62 ISVNFFAETMDKLPQVLTVGDIVQLSQVVMKTHGPEIYDLFN 103 >ref|XP_002519330.1| conserved hypothetical protein [Ricinus communis] gi|223541645|gb|EEF43194.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (2%) Frame = -1 Query: 443 IPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDES-EPRGFYLHFFANPVE 267 IP ++VDK VNLIG+ V S P K+ GTDF +KIVD+S + + F VE Sbjct: 8 IPIGEVANYVDKKVNLIGIVVEFSFPRKSNGTDFVSILKIVDQSPQSPELSANIFTEKVE 67 Query: 266 NLPSVK-NGDIVLVSNFKVK 210 +LP VK +GD++ + N ++ Sbjct: 68 HLPVVKSHGDLIFLQNVTIE 87 >gb|EXB80320.1| Protection of telomeres protein 1 [Morus notabilis] Length = 466 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/93 (38%), Positives = 55/93 (59%), Gaps = 2/93 (2%) Frame = -1 Query: 449 KFIPATNAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDES-EPRGFYLHFFANP 273 KF+ +AI+ +++ V+LIGV + P KT GTD F ++KIVD+S + G +H FA Sbjct: 8 KFLEIRDAIASINQKVSLIGVIIECGFPKKTKGTDCFCTLKIVDQSYQKPGLSVHVFAEH 67 Query: 272 VENLPSVKN-GDIVLVSNFKVK*NTFSLFYFFN 177 LP V GDIV +S+ +K + ++ FN Sbjct: 68 FGALPHVAALGDIVQLSHVMMKTHGGEVYAVFN 100 >ref|XP_004137504.1| PREDICTED: protection of telomeres protein 1a-like [Cucumis sativus] gi|449503109|ref|XP_004161838.1| PREDICTED: protection of telomeres protein 1a-like [Cucumis sativus] Length = 449 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/87 (36%), Positives = 55/87 (63%), Gaps = 2/87 (2%) Frame = -1 Query: 431 NAISHVDKFVNLIGVAVATSDPSKTVGTDFFRSIKIVDESEPR-GFYLHFFANPVENLPS 255 +AI+ +++ VN++GV + S P +T GTD F ++KIVD+S + G + FA +E LP Sbjct: 5 DAIASINQKVNIVGVIIEFSFPRRTKGTDCFCAVKIVDQSHHKPGITANIFAESLEKLPR 64 Query: 254 VKN-GDIVLVSNFKVK*NTFSLFYFFN 177 V + GDI+ +S+ +K + ++ FN Sbjct: 65 VASAGDIIELSHVTMKTHKGEIYAVFN 91