BLASTX nr result
ID: Mentha28_contig00023031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00023031 (590 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22070.1| hypothetical protein MIMGU_mgv1a005125mg [Mimulus... 66 6e-09 >gb|EYU22070.1| hypothetical protein MIMGU_mgv1a005125mg [Mimulus guttatus] Length = 496 Score = 66.2 bits (160), Expect = 6e-09 Identities = 37/79 (46%), Positives = 54/79 (68%), Gaps = 2/79 (2%) Frame = -3 Query: 585 SDSSRYSKPSFCSSSASEVSRKPLRTNP-TTSNAKRSCLDSKRKMSSRVTSDPSESNERG 409 ++ ++Y+KP+F SS+ SE +R R P +T+ AK+S LDSKRKM S+ DPSES+ Sbjct: 80 NNKAKYAKPTFSSSNGSEANRNSSRVTPVSTAGAKKSNLDSKRKMPSQSKPDPSESSSLS 139 Query: 408 NVSESTTKSKE-VNMTEAG 355 + SES KS+E +N +E G Sbjct: 140 SESESVKKSEEGLNTSEYG 158