BLASTX nr result
ID: Mentha28_contig00022123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00022123 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18737.1| hypothetical protein MIMGU_mgv1a001744mg [Mimulus... 60 3e-07 >gb|EYU18737.1| hypothetical protein MIMGU_mgv1a001744mg [Mimulus guttatus] Length = 766 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/46 (65%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +2 Query: 287 MQVQDRILPTSDSPKLHNHR---KPFSISSKNLDLSSWVSENLYKI 415 MQVQDRI P SD K HNH+ K F I +KNLD S+W SENLYKI Sbjct: 1 MQVQDRIFPPSDGSKPHNHQSRSKHFPIHTKNLDFSAWASENLYKI 46