BLASTX nr result
ID: Mentha28_contig00022107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00022107 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32153.1| hypothetical protein MIMGU_mgv1a000520mg [Mimulus... 64 3e-08 gb|EPS67848.1| hypothetical protein M569_06924, partial [Genlise... 64 3e-08 ref|XP_006292424.1| hypothetical protein CARUB_v10018639mg [Caps... 62 1e-07 ref|XP_007051742.1| Quinoprotein amine dehydrogenase, beta chain... 61 2e-07 gb|ABD28704.1| WD40-like [Medicago truncatula] 60 2e-07 ref|XP_003624005.1| RIC1-like protein [Medicago truncatula] gi|3... 60 2e-07 gb|EXC35107.1| hypothetical protein L484_021469 [Morus notabilis] 60 3e-07 ref|XP_007220289.1| hypothetical protein PRUPE_ppa000597mg [Prun... 59 5e-07 ref|XP_006491161.1| PREDICTED: protein RIC1 homolog isoform X5 [... 59 7e-07 ref|XP_006491159.1| PREDICTED: protein RIC1 homolog isoform X3 [... 59 7e-07 ref|XP_006444983.1| hypothetical protein CICLE_v10018597mg [Citr... 59 7e-07 ref|XP_006402476.1| hypothetical protein EUTSA_v10005756mg [Eutr... 59 7e-07 ref|XP_002320151.2| hypothetical protein POPTR_0014s08380g [Popu... 59 7e-07 ref|XP_003552406.1| PREDICTED: protein RIC1 homolog isoform 1 [G... 59 7e-07 ref|XP_006587839.1| PREDICTED: protein RIC1 homolog isoform X3 [... 59 9e-07 ref|XP_006587838.1| PREDICTED: protein RIC1 homolog isoform X2 [... 59 9e-07 ref|XP_002301368.2| hypothetical protein POPTR_0002s16350g [Popu... 59 9e-07 ref|XP_003534547.1| PREDICTED: protein RIC1 homolog isoformX1 [G... 59 9e-07 ref|NP_191707.3| beta-chain like quinoprotein amine dehydrogenas... 58 1e-06 ref|XP_002876617.1| hypothetical protein ARALYDRAFT_486626 [Arab... 58 1e-06 >gb|EYU32153.1| hypothetical protein MIMGU_mgv1a000520mg [Mimulus guttatus] Length = 1098 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLST 122 +DLFRH+L+LW AY+ T+QAH AFAEYHD++EEL+ +LS+ Sbjct: 1052 FDLFRHDLRLWKAYNITMQAHPAFAEYHDMIEELDEKLSS 1091 >gb|EPS67848.1| hypothetical protein M569_06924, partial [Genlisea aurea] Length = 821 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTN 125 +DLFRH+L+LW AYS TIQ H++F E+HDLL+ELE +LS++ Sbjct: 775 FDLFRHDLRLWKAYSVTIQEHESFVEFHDLLDELEAKLSSS 815 >ref|XP_006292424.1| hypothetical protein CARUB_v10018639mg [Capsella rubella] gi|482561131|gb|EOA25322.1| hypothetical protein CARUB_v10018639mg [Capsella rubella] Length = 1086 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 YD+FR++L+LW AYS T+Q+H FA+YHDLL+ LE +LS NA Sbjct: 1035 YDIFRYDLRLWKAYSMTLQSHLGFAQYHDLLQILEDKLSANA 1076 >ref|XP_007051742.1| Quinoprotein amine dehydrogenase, beta chain-like, RIC1-like guanyl-nucleotide exchange factor isoform 1 [Theobroma cacao] gi|590721886|ref|XP_007051743.1| Quinoprotein amine dehydrogenase isoform 1 [Theobroma cacao] gi|508704003|gb|EOX95899.1| Quinoprotein amine dehydrogenase, beta chain-like, RIC1-like guanyl-nucleotide exchange factor isoform 1 [Theobroma cacao] gi|508704004|gb|EOX95900.1| Quinoprotein amine dehydrogenase isoform 1 [Theobroma cacao] Length = 1122 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+++LW AYS T+Q+H +FAEYHDLL+ LE LS+ A Sbjct: 1076 FDLFRHDMRLWKAYSLTLQSHPSFAEYHDLLDVLEEELSSVA 1117 >gb|ABD28704.1| WD40-like [Medicago truncatula] Length = 1123 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+ +LW AYS T+Q+H AF EY DLLE+LE +LS+ A Sbjct: 1077 FDLFRHDFRLWKAYSSTLQSHPAFIEYQDLLEDLEDKLSSVA 1118 >ref|XP_003624005.1| RIC1-like protein [Medicago truncatula] gi|355499020|gb|AES80223.1| RIC1-like protein [Medicago truncatula] Length = 1168 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+ +LW AYS T+Q+H AF EY DLLE+LE +LS+ A Sbjct: 1122 FDLFRHDFRLWKAYSSTLQSHPAFIEYQDLLEDLEDKLSSVA 1163 >gb|EXC35107.1| hypothetical protein L484_021469 [Morus notabilis] Length = 1132 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLST 122 +DLFRH+++LW AYS T+Q+H F EYHDLLE+L+ +LS+ Sbjct: 1086 FDLFRHDMRLWKAYSITLQSHATFVEYHDLLEDLDEKLSS 1125 >ref|XP_007220289.1| hypothetical protein PRUPE_ppa000597mg [Prunus persica] gi|462416751|gb|EMJ21488.1| hypothetical protein PRUPE_ppa000597mg [Prunus persica] Length = 1080 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/42 (59%), Positives = 36/42 (85%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+++LW AYS T+Q+H AF+EYHDLL +L+ +LS+ A Sbjct: 1035 FDLFRHDMRLWKAYSITLQSHAAFSEYHDLLGDLDEQLSSIA 1076 >ref|XP_006491161.1| PREDICTED: protein RIC1 homolog isoform X5 [Citrus sinensis] Length = 905 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLST 122 +DLFRH+++LW AY+ T+Q++ AFAEYHDLLE L+ +LS+ Sbjct: 859 FDLFRHDMRLWEAYAITLQSYPAFAEYHDLLEALDEKLSS 898 >ref|XP_006491159.1| PREDICTED: protein RIC1 homolog isoform X3 [Citrus sinensis] Length = 1009 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLST 122 +DLFRH+++LW AY+ T+Q++ AFAEYHDLLE L+ +LS+ Sbjct: 963 FDLFRHDMRLWEAYAITLQSYPAFAEYHDLLEALDEKLSS 1002 >ref|XP_006444983.1| hypothetical protein CICLE_v10018597mg [Citrus clementina] gi|567904992|ref|XP_006444984.1| hypothetical protein CICLE_v10018597mg [Citrus clementina] gi|568876169|ref|XP_006491157.1| PREDICTED: protein RIC1 homolog isoform X1 [Citrus sinensis] gi|568876171|ref|XP_006491158.1| PREDICTED: protein RIC1 homolog isoform X2 [Citrus sinensis] gi|557547245|gb|ESR58223.1| hypothetical protein CICLE_v10018597mg [Citrus clementina] gi|557547246|gb|ESR58224.1| hypothetical protein CICLE_v10018597mg [Citrus clementina] Length = 1124 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLST 122 +DLFRH+++LW AY+ T+Q++ AFAEYHDLLE L+ +LS+ Sbjct: 1078 FDLFRHDMRLWEAYAITLQSYPAFAEYHDLLEALDEKLSS 1117 >ref|XP_006402476.1| hypothetical protein EUTSA_v10005756mg [Eutrema salsugineum] gi|557103575|gb|ESQ43929.1| hypothetical protein EUTSA_v10005756mg [Eutrema salsugineum] Length = 1125 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 YD+FR++L+LW AYS T+Q+H FA+YHDLL+ LE +LS A Sbjct: 1074 YDIFRYDLRLWKAYSMTLQSHLGFAQYHDLLQILEEKLSATA 1115 >ref|XP_002320151.2| hypothetical protein POPTR_0014s08380g [Populus trichocarpa] gi|550323773|gb|EEE98466.2| hypothetical protein POPTR_0014s08380g [Populus trichocarpa] Length = 1085 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLF+ +++LW AYS T+Q+H AF+EYHDLLE LE RLS+ A Sbjct: 1039 FDLFQRDMRLWKAYSVTLQSHPAFSEYHDLLEGLEERLSSVA 1080 >ref|XP_003552406.1| PREDICTED: protein RIC1 homolog isoform 1 [Glycine max] Length = 1121 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLF H+++LW AYS T+++H AF EY DLLE+LE RLS+ A Sbjct: 1075 FDLFHHDVRLWKAYSTTLESHPAFTEYQDLLEDLEERLSSVA 1116 >ref|XP_006587839.1| PREDICTED: protein RIC1 homolog isoform X3 [Glycine max] Length = 527 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+++LW AYS T+++H AF EY DLLE+LE LS+ A Sbjct: 481 FDLFRHDVRLWKAYSTTLESHPAFTEYQDLLEDLEESLSSVA 522 >ref|XP_006587838.1| PREDICTED: protein RIC1 homolog isoform X2 [Glycine max] Length = 563 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+++LW AYS T+++H AF EY DLLE+LE LS+ A Sbjct: 517 FDLFRHDVRLWKAYSTTLESHPAFTEYQDLLEDLEESLSSVA 558 >ref|XP_002301368.2| hypothetical protein POPTR_0002s16350g [Populus trichocarpa] gi|550345146|gb|EEE80641.2| hypothetical protein POPTR_0002s16350g [Populus trichocarpa] Length = 1083 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLST 122 +DLF+H+++LW AYS T+Q+ AF+EYHDLLE LE RLS+ Sbjct: 1037 FDLFQHDIRLWKAYSITLQSRPAFSEYHDLLEGLEERLSS 1076 >ref|XP_003534547.1| PREDICTED: protein RIC1 homolog isoformX1 [Glycine max] Length = 1121 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 +DLFRH+++LW AYS T+++H AF EY DLLE+LE LS+ A Sbjct: 1075 FDLFRHDVRLWKAYSTTLESHPAFTEYQDLLEDLEESLSSVA 1116 >ref|NP_191707.3| beta-chain like quinoprotein amine dehydrogenase [Arabidopsis thaliana] gi|332646689|gb|AEE80210.1| beta-chain like quinoprotein amine dehydrogenase [Arabidopsis thaliana] Length = 1080 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 YD+FR++L+LW AYS T+++H AFA+YHDLL+ LE +LS + Sbjct: 1029 YDIFRYDLRLWKAYSVTLESHLAFAQYHDLLQILEAKLSATS 1070 >ref|XP_002876617.1| hypothetical protein ARALYDRAFT_486626 [Arabidopsis lyrata subsp. lyrata] gi|297322455|gb|EFH52876.1| hypothetical protein ARALYDRAFT_486626 [Arabidopsis lyrata subsp. lyrata] Length = 1127 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 Query: 3 YDLFRHNLQLWNAYSRTIQAHDAFAEYHDLLEELEGRLSTNA 128 YD+FR++L+LW AYS T+++H AFA+YHDLL+ LE +LS + Sbjct: 1076 YDIFRYDLRLWKAYSMTLESHLAFAQYHDLLQILEEKLSATS 1117