BLASTX nr result
ID: Mentha28_contig00022041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00022041 (575 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42618.1| hypothetical protein MIMGU_mgv1a015312mg [Mimulus... 56 8e-06 >gb|EYU42618.1| hypothetical protein MIMGU_mgv1a015312mg [Mimulus guttatus] Length = 161 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 573 LGGQVLETSSEEVANAVDAISRMEKNANSYMPAIPGWQGR 454 LGGQVLETSS EV AV+ IS+ME+NANS +PA WQGR Sbjct: 124 LGGQVLETSSSEVVKAVEEISKMERNANSILPA--SWQGR 161