BLASTX nr result
ID: Mentha28_contig00022010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00022010 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35027.1| hypothetical protein MIMGU_mgv1a005734mg [Mimulus... 78 1e-12 >gb|EYU35027.1| hypothetical protein MIMGU_mgv1a005734mg [Mimulus guttatus] gi|604329855|gb|EYU35028.1| hypothetical protein MIMGU_mgv1a005734mg [Mimulus guttatus] Length = 472 Score = 77.8 bits (190), Expect = 1e-12 Identities = 41/62 (66%), Positives = 47/62 (75%), Gaps = 3/62 (4%) Frame = +2 Query: 221 AMAVAVAASPPFLGYT---LRKTLCRRRIPNSNVGFSIKAIFWGPKKAVEPTKQELALGD 391 A AVA A+S PFLG+T RKT R NS+VGFSIKAIFWGP+KA EPTK +L+LGD Sbjct: 5 AAAVAAASSSPFLGHTSFHARKTSVNRYRRNSDVGFSIKAIFWGPRKAAEPTKLDLSLGD 64 Query: 392 FS 397 FS Sbjct: 65 FS 66