BLASTX nr result
ID: Mentha28_contig00021897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00021897 (616 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27496.1| hypothetical protein MIMGU_mgv1a017725mg [Mimulus... 57 4e-06 >gb|EYU27496.1| hypothetical protein MIMGU_mgv1a017725mg [Mimulus guttatus] Length = 127 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 611 NLSVDPRRRWNPAGTSAYRSPGRGRFYQTRRWETDQCW 498 NL+V+ +RR++ G YRSPGRGRF TRRWETDQCW Sbjct: 93 NLNVNSQRRFSTGG---YRSPGRGRFQSTRRWETDQCW 127