BLASTX nr result
ID: Mentha28_contig00021803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00021803 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25243.1| hypothetical protein MIMGU_mgv1a009919mg [Mimulus... 57 3e-06 >gb|EYU25243.1| hypothetical protein MIMGU_mgv1a009919mg [Mimulus guttatus] Length = 327 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 12 METVRATTSMPFPRELANYDEVSMQQSMLFSDSLKVL 122 MET+ S+PFPRE ANYDEVSMQQSMLFSDSL+ L Sbjct: 1 METMTPPASVPFPREPANYDEVSMQQSMLFSDSLEDL 37