BLASTX nr result
ID: Mentha28_contig00021770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00021770 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27661.1| hypothetical protein MIMGU_mgv1a012649mg [Mimulus... 56 6e-06 >gb|EYU27661.1| hypothetical protein MIMGU_mgv1a012649mg [Mimulus guttatus] Length = 244 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/69 (43%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = -2 Query: 302 YPVRTCCGPCSEXXXXXXXXXXXGVPE--QXXXXXXXXXXXXYNDRPCHVIR-CDYYFNE 132 YPVRTCCG C + GVP Q +R CHVIR CDYYF+E Sbjct: 176 YPVRTCCGECYQGYGGGPCYHGYGVPPPPQPCYDGYYGYGGYGQNRSCHVIRSCDYYFSE 235 Query: 131 ENSQPCSIM 105 EN Q C++M Sbjct: 236 ENPQSCTVM 244