BLASTX nr result
ID: Mentha28_contig00021669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00021669 (737 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22070.1| hypothetical protein MIMGU_mgv1a005125mg [Mimulus... 59 2e-06 >gb|EYU22070.1| hypothetical protein MIMGU_mgv1a005125mg [Mimulus guttatus] Length = 496 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +3 Query: 567 MDRSSGKRGGAFGS--LTPRKTYGATAFKEAAIEEDQSAQFCNRIGCSGRIKFSHNAR 734 MDR GKR A G ++P+K Y + A+K + E DQ+ QFCNRIGCSGRIK S N R Sbjct: 1 MDRCPGKRVTAGGGTIMSPKKAY-SVAYKGTSNEGDQNTQFCNRIGCSGRIKCSQNPR 57