BLASTX nr result
ID: Mentha28_contig00021586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00021586 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29097.1| hypothetical protein MIMGU_mgv1a003994mg [Mimulus... 59 9e-07 >gb|EYU29097.1| hypothetical protein MIMGU_mgv1a003994mg [Mimulus guttatus] Length = 550 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 3/63 (4%) Frame = +1 Query: 253 TKSDVSPNSIDQKVRDSESCRE---MGGQNGGDYIGINIAPSPTPNHHNYKKISMIPLVF 423 TK+ S N +D+K+R + S + MG YIGIN PSP PN+H KKIS++PLVF Sbjct: 53 TKTQTSNNHMDEKLRGARSGQTSTVMGEHRDSQYIGINEGPSPRPNNHG-KKISVLPLVF 111 Query: 424 LIF 432 LIF Sbjct: 112 LIF 114