BLASTX nr result
ID: Mentha28_contig00020772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00020772 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43038.1| hypothetical protein MIMGU_mgv11b002848mg [Mimulu... 81 1e-13 gb|EPS67125.1| hypothetical protein M569_07651, partial [Genlise... 57 3e-06 >gb|EYU43038.1| hypothetical protein MIMGU_mgv11b002848mg [Mimulus guttatus] Length = 585 Score = 81.3 bits (199), Expect = 1e-13 Identities = 47/90 (52%), Positives = 53/90 (58%), Gaps = 33/90 (36%) Frame = +2 Query: 293 LDSPRTPGSERPTRERKTVERFMVGDTPKASASKTLSI---------------------- 406 L SPRTPGSERPTRERKTVERFMVG++ + SA+KTLSI Sbjct: 137 LKSPRTPGSERPTRERKTVERFMVGESARGSATKTLSIEKGRGTQLKEIPNVAFKLSKRK 196 Query: 407 -----------LFGKKSKVHSLKKNIGLFS 463 LFGKK+K H+LKKNIGLFS Sbjct: 197 VDENLQLLHTVLFGKKAKAHTLKKNIGLFS 226 >gb|EPS67125.1| hypothetical protein M569_07651, partial [Genlisea aurea] Length = 351 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/88 (37%), Positives = 45/88 (51%), Gaps = 33/88 (37%) Frame = +2 Query: 299 SPRTPGSERPTRERKTVERFMVGDTPKASASKTLS------------------------- 403 SPR GS+RP+RERKTV+R++ P+ S+ K++S Sbjct: 109 SPRASGSDRPSRERKTVDRYISPQAPRGSSGKSVSIEKGRGMQLKDIPNVAFKLSKRKAD 168 Query: 404 --------ILFGKKSKVHSLKKNIGLFS 463 ILFGKK+K S+K+NIGLFS Sbjct: 169 ENLQLLHTILFGKKAKAQSMKRNIGLFS 196