BLASTX nr result
ID: Mentha28_contig00020541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00020541 (880 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41544.1| hypothetical protein MIMGU_mgv1a000267mg [Mimulus... 60 8e-07 >gb|EYU41544.1| hypothetical protein MIMGU_mgv1a000267mg [Mimulus guttatus] Length = 1326 Score = 60.5 bits (145), Expect = 8e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +3 Query: 732 TTKGSYQSGRKLQAELVDVQLPKRTRSPTIPSPNGNFVPNPA 857 +T G+YQSGR Q VD LPKRTRSPTIPSP+G F NPA Sbjct: 5 STSGAYQSGRTFQTTHVDGSLPKRTRSPTIPSPSGGFTQNPA 46