BLASTX nr result
ID: Mentha28_contig00020278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00020278 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32230.1| hypothetical protein MIMGU_mgv1a008555mg [Mimulus... 59 9e-07 gb|EYU38897.1| hypothetical protein MIMGU_mgv1a0093161mg, partia... 57 3e-06 >gb|EYU32230.1| hypothetical protein MIMGU_mgv1a008555mg [Mimulus guttatus] Length = 369 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -1 Query: 127 MTNVQDQQNSQDIKPNIISHDSQTELPNNAAEGAIPDSGSVS 2 M VQD+QNS D+KPNII HDSQ ELPNN E I DSGSVS Sbjct: 1 MKKVQDKQNSPDVKPNII-HDSQNELPNNGTETFIQDSGSVS 41 >gb|EYU38897.1| hypothetical protein MIMGU_mgv1a0093161mg, partial [Mimulus guttatus] Length = 342 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -1 Query: 127 MTNVQDQQNSQDIKP-NIISHDSQTELPNNAAEGAIPDSGSVS 2 M +VQDQ ++Q+IKP N+++HDSQ LPNNA E +PDSGS+S Sbjct: 1 MRSVQDQSDAQEIKPTNLVTHDSQNVLPNNANETPVPDSGSIS 43