BLASTX nr result
ID: Mentha28_contig00020259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00020259 (631 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213603.1| hypothetical protein PRUPE_ppa002422mg [Prun... 75 2e-11 gb|EXB64620.1| hypothetical protein L484_017952 [Morus notabilis] 74 4e-11 gb|EPS67528.1| hypothetical protein M569_07242 [Genlisea aurea] 74 4e-11 ref|XP_003635587.1| PREDICTED: probable galactinol--sucrose gala... 74 5e-11 ref|XP_002269491.2| PREDICTED: probable galactinol--sucrose gala... 74 5e-11 emb|CBI25920.3| unnamed protein product [Vitis vinifera] 74 5e-11 emb|CBI29568.3| unnamed protein product [Vitis vinifera] 74 5e-11 ref|XP_006373562.1| hypothetical protein POPTR_0016s00410g [Popu... 72 1e-10 ref|XP_004295336.1| PREDICTED: probable galactinol--sucrose gala... 71 3e-10 gb|EYU17751.1| hypothetical protein MIMGU_mgv1a001848mg [Mimulus... 70 7e-10 ref|XP_002278889.1| PREDICTED: probable galactinol--sucrose gala... 70 7e-10 emb|CAN61133.1| hypothetical protein VITISV_039575 [Vitis vinifera] 70 7e-10 ref|XP_006493815.1| PREDICTED: probable galactinol--sucrose gala... 69 9e-10 ref|XP_006420906.1| hypothetical protein CICLE_v10004399mg [Citr... 69 9e-10 ref|XP_002525224.1| Stachyose synthase precursor, putative [Rici... 69 9e-10 ref|XP_007026419.1| Seed imbibition 2 [Theobroma cacao] gi|50878... 69 1e-09 gb|EYU33826.1| hypothetical protein MIMGU_mgv1a001573mg [Mimulus... 69 1e-09 ref|XP_006586801.1| PREDICTED: probable galactinol--sucrose gala... 69 1e-09 ref|XP_003534998.2| PREDICTED: probable galactinol--sucrose gala... 69 1e-09 ref|XP_006586800.1| PREDICTED: probable galactinol--sucrose gala... 69 1e-09 >ref|XP_007213603.1| hypothetical protein PRUPE_ppa002422mg [Prunus persica] gi|462409468|gb|EMJ14802.1| hypothetical protein PRUPE_ppa002422mg [Prunus persica] Length = 674 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEIL+R VLPDGS+LRA+YPGRPSRDCLFVDPV+DGK Sbjct: 439 DFEILKRLVLPDGSILRARYPGRPSRDCLFVDPVMDGK 476 >gb|EXB64620.1| hypothetical protein L484_017952 [Morus notabilis] Length = 763 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDG 113 DFEIL+R VLPDGS+LRAKYPGRPSRDCLF+DPV+DG Sbjct: 530 DFEILKRLVLPDGSILRAKYPGRPSRDCLFIDPVMDG 566 >gb|EPS67528.1| hypothetical protein M569_07242 [Genlisea aurea] Length = 787 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEIL+R VLPDGSVLRAKYPGRPSRDCLF DPV DGK Sbjct: 551 DFEILKRLVLPDGSVLRAKYPGRPSRDCLFADPVSDGK 588 >ref|XP_003635587.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like, partial [Vitis vinifera] Length = 259 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEILRR VLPDGSVLRAKYPGRPSRDCLF DPV+DG+ Sbjct: 118 DFEILRRLVLPDGSVLRAKYPGRPSRDCLFNDPVMDGE 155 >ref|XP_002269491.2| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like [Vitis vinifera] Length = 789 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEILRR VLPDGSVLRAKYPGRPSRDCLF DPV+DG+ Sbjct: 557 DFEILRRLVLPDGSVLRAKYPGRPSRDCLFNDPVMDGE 594 >emb|CBI25920.3| unnamed protein product [Vitis vinifera] Length = 244 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEILRR VLPDGSVLRAKYPGRPSRDCLF DPV+DG+ Sbjct: 87 DFEILRRLVLPDGSVLRAKYPGRPSRDCLFNDPVMDGE 124 >emb|CBI29568.3| unnamed protein product [Vitis vinifera] Length = 739 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEILRR VLPDGSVLRAKYPGRPSRDCLF DPV+DG+ Sbjct: 507 DFEILRRLVLPDGSVLRAKYPGRPSRDCLFNDPVMDGE 544 >ref|XP_006373562.1| hypothetical protein POPTR_0016s00410g [Populus trichocarpa] gi|550320472|gb|ERP51359.1| hypothetical protein POPTR_0016s00410g [Populus trichocarpa] Length = 812 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 D +IL+R VLPDGSVLRAKYPGRPSRDCLF+DPV+DGK Sbjct: 575 DHKILKRLVLPDGSVLRAKYPGRPSRDCLFIDPVMDGK 612 >ref|XP_004295336.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like [Fragaria vesca subsp. vesca] Length = 851 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DFEIL+R VL DGSVLRA+YPGRPSRDCLFVDPV+DG+ Sbjct: 619 DFEILKRLVLADGSVLRARYPGRPSRDCLFVDPVMDGE 656 >gb|EYU17751.1| hypothetical protein MIMGU_mgv1a001848mg [Mimulus guttatus] gi|604297539|gb|EYU17752.1| hypothetical protein MIMGU_mgv1a001848mg [Mimulus guttatus] Length = 750 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF+ILR+ VLPDGSVLRA+Y GRP+RDCLFVDPV+DGK Sbjct: 518 DFKILRKLVLPDGSVLRARYSGRPTRDCLFVDPVMDGK 555 >ref|XP_002278889.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Vitis vinifera] gi|297733664|emb|CBI14911.3| unnamed protein product [Vitis vinifera] Length = 750 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF IL+R VLPDGSVLRAKYPGRP+RDCLF DPV+DG+ Sbjct: 515 DFRILKRLVLPDGSVLRAKYPGRPTRDCLFKDPVMDGE 552 >emb|CAN61133.1| hypothetical protein VITISV_039575 [Vitis vinifera] Length = 1122 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF IL+R VLPDGSVLRAKYPGRP+RDCLF DPV+DG+ Sbjct: 651 DFRILKRLVLPDGSVLRAKYPGRPTRDCLFKDPVMDGE 688 >ref|XP_006493815.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like [Citrus sinensis] Length = 812 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF+IL+R VL DGSVLRAKYPGRPSRDCLF DPV+DGK Sbjct: 578 DFKILKRLVLADGSVLRAKYPGRPSRDCLFNDPVMDGK 615 >ref|XP_006420906.1| hypothetical protein CICLE_v10004399mg [Citrus clementina] gi|557522779|gb|ESR34146.1| hypothetical protein CICLE_v10004399mg [Citrus clementina] Length = 748 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF+IL+R VL DGSVLRAKYPGRPSRDCLF DPV+DGK Sbjct: 514 DFKILKRLVLADGSVLRAKYPGRPSRDCLFNDPVMDGK 551 >ref|XP_002525224.1| Stachyose synthase precursor, putative [Ricinus communis] gi|223535521|gb|EEF37190.1| Stachyose synthase precursor, putative [Ricinus communis] Length = 793 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGKRYSSSDEIW 143 DF IL++ VLPDGSVLRAKYPGRP+RDCLF DPV+DG+ S +IW Sbjct: 564 DFNILKKLVLPDGSVLRAKYPGRPTRDCLFSDPVMDGR---SLMKIW 607 >ref|XP_007026419.1| Seed imbibition 2 [Theobroma cacao] gi|508781785|gb|EOY29041.1| Seed imbibition 2 [Theobroma cacao] Length = 799 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF IL R VL DGSVLRAKYPGRPSRDCLF DPV+DGK Sbjct: 562 DFTILERLVLSDGSVLRAKYPGRPSRDCLFTDPVMDGK 599 >gb|EYU33826.1| hypothetical protein MIMGU_mgv1a001573mg [Mimulus guttatus] Length = 792 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGKRYSSSDEIW 143 DF+IL+R VLP+GSVLRAKY GRP RDCLFVDPV+DGK S +IW Sbjct: 560 DFDILKRLVLPNGSVLRAKYHGRPCRDCLFVDPVMDGK---SLMKIW 603 >ref|XP_006586801.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like isoform X3 [Glycine max] Length = 734 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF +L++ VLPDGSVLRA+YPGRPSRDCLF+DPV+D K Sbjct: 503 DFNVLKKLVLPDGSVLRARYPGRPSRDCLFIDPVMDKK 540 >ref|XP_003534998.2| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like isoform X1 [Glycine max] Length = 797 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF +L++ VLPDGSVLRA+YPGRPSRDCLF+DPV+D K Sbjct: 566 DFNVLKKLVLPDGSVLRARYPGRPSRDCLFIDPVMDKK 603 >ref|XP_006586800.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like isoform X2 [Glycine max] Length = 804 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 DFEILRRPVLPDGSVLRAKYPGRPSRDCLFVDPVVDGK 116 DF +L++ VLPDGSVLRA+YPGRPSRDCLF+DPV+D K Sbjct: 573 DFNVLKKLVLPDGSVLRARYPGRPSRDCLFIDPVMDKK 610