BLASTX nr result
ID: Mentha28_contig00020216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00020216 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514434.1| Ubiquitin carboxyl-terminal hydrolase, putat... 85 5e-21 ref|XP_002310965.1| NtN2 family protein [Populus trichocarpa] gi... 85 6e-21 gb|ACJ04334.1| ubiquitin specific protease 12 [Nicotiana tabacum] 86 8e-21 ref|XP_002316470.1| NtN2 family protein [Populus trichocarpa] gi... 84 8e-21 ref|XP_006345885.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 1e-20 ref|XP_002267555.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 88 1e-20 emb|CBI39086.3| unnamed protein product [Vitis vinifera] 88 1e-20 ref|XP_002263912.2| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 1e-20 ref|XP_004249927.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 87 2e-20 ref|XP_006350937.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 7e-20 ref|XP_006350939.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 7e-20 ref|XP_006350938.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 7e-20 ref|XP_006350940.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 7e-20 ref|XP_006826384.1| hypothetical protein AMTR_s00004p00140970 [A... 84 9e-20 gb|EXB97675.1| Ubiquitin carboxyl-terminal hydrolase 12 [Morus n... 80 1e-19 ref|XP_007220914.1| hypothetical protein PRUPE_ppa000553mg [Prun... 83 1e-19 ref|XP_002309275.1| UBIQUITIN-SPECIFIC PROTEASE 12 family protei... 84 1e-19 ref|XP_007010559.1| Ubiquitin-specific protease 12 isoform 2 [Th... 79 3e-19 ref|XP_006487815.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 82 3e-19 ref|XP_006424036.1| hypothetical protein CICLE_v10027709mg [Citr... 82 3e-19 >ref|XP_002514434.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223546430|gb|EEF47930.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 1109 Score = 85.1 bits (209), Expect(2) = 5e-21 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPEKTKEDILLFFKLYDP KEELRY+GRLFVK GKP +IL KL Sbjct: 679 PIPPPEKTKEDILLFFKLYDPSKEELRYVGRLFVKGAGKPLEILTKL 725 Score = 41.6 bits (96), Expect(2) = 5e-21 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKANNAELKLFL Sbjct: 650 VGQLREVSNKANNAELKLFL 669 >ref|XP_002310965.1| NtN2 family protein [Populus trichocarpa] gi|222850785|gb|EEE88332.1| NtN2 family protein [Populus trichocarpa] Length = 1131 Score = 84.7 bits (208), Expect(2) = 6e-21 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPEKTK+DILLFFKLYDP KEELRY+GRLFVK +GKP +IL KL Sbjct: 679 PVPPPEKTKDDILLFFKLYDPSKEELRYVGRLFVKGSGKPLEILTKL 725 Score = 41.6 bits (96), Expect(2) = 6e-21 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKANNAELKLFL Sbjct: 650 VGQLREVSNKANNAELKLFL 669 >gb|ACJ04334.1| ubiquitin specific protease 12 [Nicotiana tabacum] Length = 1116 Score = 85.5 bits (210), Expect(2) = 8e-21 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP +IL KL Sbjct: 679 PCPPPEKTKEDILLFFKLYDPLKEEMRYVGRLFVKGSGKPLEILTKL 725 Score = 40.4 bits (93), Expect(2) = 8e-21 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKANNAELKL+L Sbjct: 650 VGQLREVSNKANNAELKLYL 669 >ref|XP_002316470.1| NtN2 family protein [Populus trichocarpa] gi|222865510|gb|EEF02641.1| NtN2 family protein [Populus trichocarpa] Length = 1116 Score = 84.3 bits (207), Expect(2) = 8e-21 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPEKTKEDILLFFKLYDP KE+LRY+GRLFVK +GKP +IL KL Sbjct: 679 PVPPPEKTKEDILLFFKLYDPSKEKLRYVGRLFVKGSGKPLEILTKL 725 Score = 41.6 bits (96), Expect(2) = 8e-21 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKANNAELKLFL Sbjct: 650 VGQLREVSNKANNAELKLFL 669 >ref|XP_006345885.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Solanum tuberosum] Length = 1119 Score = 85.9 bits (211), Expect(2) = 1e-20 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP +IL KL Sbjct: 682 PFPPPEKTKEDILLFFKLYDPLKEEIRYVGRLFVKGSGKPLEILAKL 728 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKAN+AELKLFL Sbjct: 653 VGQLREVSNKANHAELKLFL 672 >ref|XP_002267555.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Vitis vinifera] Length = 1117 Score = 87.8 bits (216), Expect(2) = 1e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPEKTKEDILLFFKLYDP KEELRY+GRLFVKS+GKP +IL KL Sbjct: 680 PIPPPEKTKEDILLFFKLYDPEKEELRYVGRLFVKSSGKPIEILTKL 726 Score = 37.7 bits (86), Expect(2) = 1e-20 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVS K NNAELKLFL Sbjct: 651 VGQLREVSTKVNNAELKLFL 670 >emb|CBI39086.3| unnamed protein product [Vitis vinifera] Length = 1116 Score = 87.8 bits (216), Expect(2) = 1e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPEKTKEDILLFFKLYDP KEELRY+GRLFVKS+GKP +IL KL Sbjct: 680 PIPPPEKTKEDILLFFKLYDPEKEELRYVGRLFVKSSGKPIEILTKL 726 Score = 37.7 bits (86), Expect(2) = 1e-20 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVS K NNAELKLFL Sbjct: 651 VGQLREVSTKVNNAELKLFL 670 >ref|XP_002263912.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Vitis vinifera] gi|296084432|emb|CBI24991.3| unnamed protein product [Vitis vinifera] Length = 1115 Score = 85.9 bits (211), Expect(2) = 1e-20 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPEKTKE+ILLFFKLYDP+KEELRY+GRLFVK +GKP +IL KL Sbjct: 678 PVPPPEKTKEEILLFFKLYDPLKEELRYVGRLFVKGSGKPIEILSKL 724 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKAN+AELKLFL Sbjct: 649 VGQLREVSNKANHAELKLFL 668 >ref|XP_004249927.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Solanum lycopersicum] Length = 1116 Score = 87.4 bits (215), Expect(2) = 2e-20 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP DIL KL Sbjct: 679 PCPPPEKTKEDILLFFKLYDPLKEEIRYVGRLFVKGSGKPLDILSKL 725 Score = 37.0 bits (84), Expect(2) = 2e-20 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK +NAELKL+L Sbjct: 650 VGQLREVSNKTSNAELKLYL 669 >ref|XP_006350937.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X1 [Solanum tuberosum] Length = 1118 Score = 86.3 bits (212), Expect(2) = 7e-20 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP DI+ KL Sbjct: 680 PCPPPEKTKEDILLFFKLYDPLKEEIRYVGRLFVKGSGKPLDIMTKL 726 Score = 36.6 bits (83), Expect(2) = 7e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK NAELKL+L Sbjct: 651 VGQLREVSNKTTNAELKLYL 670 >ref|XP_006350939.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X3 [Solanum tuberosum] Length = 1117 Score = 86.3 bits (212), Expect(2) = 7e-20 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP DI+ KL Sbjct: 679 PCPPPEKTKEDILLFFKLYDPLKEEIRYVGRLFVKGSGKPLDIMTKL 725 Score = 36.6 bits (83), Expect(2) = 7e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK NAELKL+L Sbjct: 650 VGQLREVSNKTTNAELKLYL 669 >ref|XP_006350938.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X2 [Solanum tuberosum] Length = 1117 Score = 86.3 bits (212), Expect(2) = 7e-20 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP DI+ KL Sbjct: 680 PCPPPEKTKEDILLFFKLYDPLKEEIRYVGRLFVKGSGKPLDIMTKL 726 Score = 36.6 bits (83), Expect(2) = 7e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK NAELKL+L Sbjct: 651 VGQLREVSNKTTNAELKLYL 670 >ref|XP_006350940.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X4 [Solanum tuberosum] Length = 1116 Score = 86.3 bits (212), Expect(2) = 7e-20 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P PPPEKTKEDILLFFKLYDP+KEE+RY+GRLFVK +GKP DI+ KL Sbjct: 679 PCPPPEKTKEDILLFFKLYDPLKEEIRYVGRLFVKGSGKPLDIMTKL 725 Score = 36.6 bits (83), Expect(2) = 7e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK NAELKL+L Sbjct: 650 VGQLREVSNKTTNAELKLYL 669 >ref|XP_006826384.1| hypothetical protein AMTR_s00004p00140970 [Amborella trichopoda] gi|548830698|gb|ERM93621.1| hypothetical protein AMTR_s00004p00140970 [Amborella trichopoda] Length = 940 Score = 84.0 bits (206), Expect(2) = 9e-20 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+ PPEKTKEDILLFFKLYDP KEELRY+GRLFVKS+GKP +IL KL Sbjct: 503 PILPPEKTKEDILLFFKLYDPEKEELRYVGRLFVKSSGKPIEILTKL 549 Score = 38.5 bits (88), Expect(2) = 9e-20 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKA+NAEL+LFL Sbjct: 474 VGQLREVSNKAHNAELRLFL 493 >gb|EXB97675.1| Ubiquitin carboxyl-terminal hydrolase 12 [Morus notabilis] Length = 1996 Score = 80.5 bits (197), Expect(2) = 1e-19 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+ PEKTKE+ILLFFKLYDPVKEELRY+GRLFVK GKP +IL KL Sbjct: 682 PVATPEKTKEEILLFFKLYDPVKEELRYVGRLFVKGTGKPAEILTKL 728 Score = 41.6 bits (96), Expect(2) = 1e-19 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKANNAELKLFL Sbjct: 653 VGQLREVSNKANNAELKLFL 672 >ref|XP_007220914.1| hypothetical protein PRUPE_ppa000553mg [Prunus persica] gi|462417376|gb|EMJ22113.1| hypothetical protein PRUPE_ppa000553mg [Prunus persica] Length = 1098 Score = 82.8 bits (203), Expect(2) = 1e-19 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 PL PPEKTKE+ILLFFKLYDPVKEELRY+GRLFVK +GKP ++ KL Sbjct: 663 PLSPPEKTKEEILLFFKLYDPVKEELRYVGRLFVKGSGKPVELFAKL 709 Score = 39.3 bits (90), Expect(2) = 1e-19 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VG+LREVSNK+NNAELKLFL Sbjct: 634 VGELREVSNKSNNAELKLFL 653 >ref|XP_002309275.1| UBIQUITIN-SPECIFIC PROTEASE 12 family protein [Populus trichocarpa] gi|222855251|gb|EEE92798.1| UBIQUITIN-SPECIFIC PROTEASE 12 family protein [Populus trichocarpa] Length = 1239 Score = 83.6 bits (205), Expect(2) = 1e-19 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+ PPEKTKEDILLFFKLYDP K+ELRY+GRLFVKS+GKP +IL KL Sbjct: 697 PIAPPEKTKEDILLFFKLYDPEKQELRYVGRLFVKSSGKPIEILAKL 743 Score = 38.1 bits (87), Expect(2) = 1e-19 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK +NAELKLFL Sbjct: 668 VGQLREVSNKTHNAELKLFL 687 >ref|XP_007010559.1| Ubiquitin-specific protease 12 isoform 2 [Theobroma cacao] gi|508727472|gb|EOY19369.1| Ubiquitin-specific protease 12 isoform 2 [Theobroma cacao] Length = 1146 Score = 79.0 bits (193), Expect(2) = 3e-19 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+PPPE+TKEDILLFFKLYDP KEE RY+GR++V+S GKP +IL ++ Sbjct: 676 PVPPPERTKEDILLFFKLYDPFKEEFRYVGRMYVRSAGKPMEILARI 722 Score = 41.6 bits (96), Expect(2) = 3e-19 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNKANNAELKLFL Sbjct: 647 VGQLREVSNKANNAELKLFL 666 >ref|XP_006487815.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 13-like [Citrus sinensis] Length = 1118 Score = 82.4 bits (202), Expect(2) = 3e-19 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+ PPEKTKEDILLFFKLYDP KEELRY+GRLFVKS GKP + L KL Sbjct: 681 PIAPPEKTKEDILLFFKLYDPEKEELRYVGRLFVKSTGKPMEYLPKL 727 Score = 38.1 bits (87), Expect(2) = 3e-19 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK +NAELKLFL Sbjct: 652 VGQLREVSNKVHNAELKLFL 671 >ref|XP_006424036.1| hypothetical protein CICLE_v10027709mg [Citrus clementina] gi|567862766|ref|XP_006424037.1| hypothetical protein CICLE_v10027709mg [Citrus clementina] gi|557525970|gb|ESR37276.1| hypothetical protein CICLE_v10027709mg [Citrus clementina] gi|557525971|gb|ESR37277.1| hypothetical protein CICLE_v10027709mg [Citrus clementina] Length = 1118 Score = 82.4 bits (202), Expect(2) = 3e-19 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +3 Query: 162 PLPPPEKTKEDILLFFKLYDPVKEELRYIGRLFVKSNGKPTDILKKL 302 P+ PPEKTKEDILLFFKLYDP KEELRY+GRLFVKS GKP + L KL Sbjct: 681 PIAPPEKTKEDILLFFKLYDPEKEELRYVGRLFVKSTGKPMEYLPKL 727 Score = 38.1 bits (87), Expect(2) = 3e-19 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +2 Query: 95 VGQLREVSNKANNAELKLFL 154 VGQLREVSNK +NAELKLFL Sbjct: 652 VGQLREVSNKVHNAELKLFL 671