BLASTX nr result
ID: Mentha28_contig00020026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00020026 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Mimulus... 78 1e-12 ref|XP_004232583.1| PREDICTED: uncharacterized transporter YBR28... 78 1e-12 gb|EYU30840.1| hypothetical protein MIMGU_mgv1a0088072mg, partia... 77 2e-12 gb|EXB95111.1| putative transporter [Morus notabilis] 75 7e-12 ref|XP_007202341.1| hypothetical protein PRUPE_ppa008223mg [Prun... 72 1e-10 ref|XP_004146180.1| PREDICTED: uncharacterized transporter YBR28... 71 1e-10 ref|XP_002306421.2| auxin efflux carrier family protein [Populus... 70 2e-10 ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Popu... 70 2e-10 gb|ABQ95657.1| auxin hydrogen symporter [Malus domestica] 70 2e-10 ref|XP_004287713.1| PREDICTED: uncharacterized transporter YBR28... 70 3e-10 ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 70 4e-10 ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR28... 69 7e-10 ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [A... 69 9e-10 ref|XP_006393787.1| hypothetical protein EUTSA_v10005581mg [Eutr... 68 1e-09 ref|XP_006282359.1| hypothetical protein CARUB_v10028656mg [Caps... 68 1e-09 ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsi... 68 1e-09 ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp.... 68 1e-09 ref|XP_003612404.1| Transporter, putative [Medicago truncatula] ... 67 2e-09 ref|XP_003612391.1| hypothetical protein MTR_5g024520 [Medicago ... 67 3e-09 ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR28... 66 4e-09 >gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Mimulus guttatus] Length = 394 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGFL+LLKVASMPI+Q+LII +LGAFMATDYLNLL DARK +NKIVF Sbjct: 1 MGFLSLLKVASMPIVQVLIIGILGAFMATDYLNLLSSDARKSLNKIVF 48 >ref|XP_004232583.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] Length = 405 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF+TLL+VASMPI+Q+LI+S LGA MATDYL LLP DARKY+N+IVF Sbjct: 1 MGFMTLLEVASMPILQVLIVSGLGAVMATDYLKLLPADARKYLNRIVF 48 >gb|EYU30840.1| hypothetical protein MIMGU_mgv1a0088072mg, partial [Mimulus guttatus] Length = 77 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGFL+LL+VASMPI+Q+LIIS+LGAFMATDYLNLL DARK +NKIV+ Sbjct: 1 MGFLSLLRVASMPIVQVLIISILGAFMATDYLNLLSSDARKSLNKIVY 48 >gb|EXB95111.1| putative transporter [Morus notabilis] Length = 426 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TLL+VASMPI+Q+LI+ MLGAFMAT Y NLLP D+RK +NKIVF Sbjct: 1 MGFFTLLEVASMPILQVLIVGMLGAFMATSYWNLLPADSRKSLNKIVF 48 >ref|XP_007202341.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica] gi|595805765|ref|XP_007202342.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica] gi|595805773|ref|XP_007202343.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica] gi|462397872|gb|EMJ03540.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica] gi|462397873|gb|EMJ03541.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica] gi|462397874|gb|EMJ03542.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica] Length = 340 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TLL+VA MP Q+LIIS+LGAFMAT+Y NLLP DAR+ MNK+VF Sbjct: 1 MGFWTLLEVACMPTFQVLIISVLGAFMATEYWNLLPVDARRSMNKVVF 48 >ref|XP_004146180.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] gi|449495139|ref|XP_004159745.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 434 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MG L+LL+VASMP +QLL+IS+LGAF+ATDY N+LPP A K +NKIVF Sbjct: 1 MGLLSLLEVASMPNIQLLLISLLGAFLATDYCNILPPHATKSLNKIVF 48 >ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa] gi|566170511|ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170513|ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170515|ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338531|gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550338532|gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338533|gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338534|gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 418 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TL +VAS+PI+Q+L+IS GA MAT+YLNLLP DARK +NK+VF Sbjct: 1 MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVF 48 >ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] gi|550309392|gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] Length = 428 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TL +VAS+PI+Q+L+IS GA MAT+YLNLLP DARK +NK+VF Sbjct: 1 MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVF 48 >gb|ABQ95657.1| auxin hydrogen symporter [Malus domestica] Length = 412 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TLL+VA MPI Q+LIIS+LGA MAT+Y NLLP DARK +NK+VF Sbjct: 1 MGFWTLLEVACMPIFQVLIISVLGALMATEYWNLLPLDARKSINKVVF 48 >ref|XP_004287713.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria vesca subsp. vesca] Length = 411 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TL +VASMP++Q+LIIS+LGA+MAT+Y NLLP AR+ +NKIVF Sbjct: 1 MGFWTLFEVASMPVLQVLIISLLGAYMATEYCNLLPLGARRSLNKIVF 48 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TL +VASMPI+Q+L+IS LGAFMAT+Y NLL DARK +NKIVF Sbjct: 1 MGFWTLFEVASMPIIQVLLISGLGAFMATNYCNLLTSDARKSLNKIVF 48 >ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera] gi|296082565|emb|CBI21570.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TL +VASMPI+Q+LII +GAF+AT Y N+LP DARK +NKIVF Sbjct: 1 MGFWTLFEVASMPILQVLIIGSVGAFLATGYCNILPADARKSVNKIVF 48 >ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda] gi|548859461|gb|ERN17141.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda] Length = 429 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF +L VASMPI+++L+IS LGAF+AT Y N+L PDAR+Y+NK+VF Sbjct: 1 MGFSSLFVVASMPILEVLLISCLGAFLATGYCNVLTPDARRYINKVVF 48 >ref|XP_006393787.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum] gi|557090426|gb|ESQ31073.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum] Length = 395 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGFL LL+VASMPI+Q+L+IS+LGAF+ATDY +LL D R+ +NK+VF Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVF 48 >ref|XP_006282359.1| hypothetical protein CARUB_v10028656mg [Capsella rubella] gi|482551063|gb|EOA15257.1| hypothetical protein CARUB_v10028656mg [Capsella rubella] Length = 395 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGFL LL+VASMPI+Q+L+IS+LGAF+ATDY +LL D R+ +NK+VF Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVF 48 >ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|10177113|dbj|BAB10403.1| unnamed protein product [Arabidopsis thaliana] gi|332010751|gb|AED98134.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 395 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGFL LL+VASMPI+Q+L+IS+LGAF+ATDY +LL D R+ +NK+VF Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVF 48 >ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312615|gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 395 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGFL LL+VASMPI+Q+L+IS+LGAF+ATDY +LL D R+ +NK+VF Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVF 48 >ref|XP_003612404.1| Transporter, putative [Medicago truncatula] gi|355513739|gb|AES95362.1| Transporter, putative [Medicago truncatula] Length = 420 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/49 (69%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYL-NLLPPDARKYMNKIVF 420 MGFL LL+VASMP++Q+L+IS LGAFMAT Y NLL PD RK +NK+VF Sbjct: 1 MGFLQLLEVASMPVIQVLLISALGAFMATQYFNNLLSPDFRKSLNKVVF 49 >ref|XP_003612391.1| hypothetical protein MTR_5g024520 [Medicago truncatula] gi|355513726|gb|AES95349.1| hypothetical protein MTR_5g024520 [Medicago truncatula] Length = 381 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYL-NLLPPDARKYMNKIVF 420 MGF+ LL+VASMP++Q+L+IS LGAFMAT Y NLL PD RK +NK+VF Sbjct: 1 MGFIQLLEVASMPVIQVLLISALGAFMATQYFNNLLSPDFRKSLNKVVF 49 >ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum tuberosum] Length = 395 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = +1 Query: 277 MGFLTLLKVASMPIMQLLIISMLGAFMATDYLNLLPPDARKYMNKIVF 420 MGF TL +VASMPI+Q+L+IS+LGA MAT+Y N+L D R+ +NKIVF Sbjct: 1 MGFWTLFEVASMPILQMLLISVLGALMATNYFNILHSDTRRSLNKIVF 48