BLASTX nr result
ID: Mentha28_contig00019939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00019939 (805 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21389.1| hypothetical protein MIMGU_mgv1a000200mg [Mimulus... 52 8e-07 gb|EYU21390.1| hypothetical protein MIMGU_mgv1a000200mg [Mimulus... 52 8e-07 >gb|EYU21389.1| hypothetical protein MIMGU_mgv1a000200mg [Mimulus guttatus] Length = 1444 Score = 52.4 bits (124), Expect(2) = 8e-07 Identities = 26/55 (47%), Positives = 34/55 (61%) Frame = -3 Query: 803 LVSIEYYVAVVYGFITKGKGFSHPNWFILFSRGTIWMALCIFVIVRGSEWISILK 639 +VSI+YY V+Y I + FS NWF F RG IW L + +VRGS+ S+LK Sbjct: 63 VVSIQYYGVVIY--IIESNDFSRTNWFAYFFRGLIWTTLSVSSLVRGSKRASVLK 115 Score = 27.7 bits (60), Expect(2) = 8e-07 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 636 AWWFVFFLSISAL 598 AWW +FF+SISAL Sbjct: 117 AWWILFFVSISAL 129 >gb|EYU21390.1| hypothetical protein MIMGU_mgv1a000200mg [Mimulus guttatus] Length = 1412 Score = 52.4 bits (124), Expect(2) = 8e-07 Identities = 26/55 (47%), Positives = 34/55 (61%) Frame = -3 Query: 803 LVSIEYYVAVVYGFITKGKGFSHPNWFILFSRGTIWMALCIFVIVRGSEWISILK 639 +VSI+YY V+Y I + FS NWF F RG IW L + +VRGS+ S+LK Sbjct: 63 VVSIQYYGVVIY--IIESNDFSRTNWFAYFFRGLIWTTLSVSSLVRGSKRASVLK 115 Score = 27.7 bits (60), Expect(2) = 8e-07 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 636 AWWFVFFLSISAL 598 AWW +FF+SISAL Sbjct: 117 AWWILFFVSISAL 129