BLASTX nr result
ID: Mentha28_contig00019807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00019807 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364355.1| PREDICTED: probable serine/threonine-protein... 60 3e-07 ref|XP_004231098.1| PREDICTED: probable serine/threonine-protein... 57 2e-06 >ref|XP_006364355.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like [Solanum tuberosum] Length = 418 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +3 Query: 6 IDTANERPRQPRVHASYHTADRRVQQHLQYRSPNHTRQEVNRAYPLPPRA 155 I+ ANERP++PR+ + + TA R Q L +RSP H R +VNRAYPLP RA Sbjct: 368 IEAANERPKEPRITSRHQTAYRYGQPPLHHRSPLHPRNDVNRAYPLPRRA 417 >ref|XP_004231098.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like [Solanum lycopersicum] Length = 410 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +3 Query: 6 IDTANERPRQPRVHASYHTADRRVQQHLQYRSPNHTRQEVNRAYPLPPRA 155 I+ ANERP++PR+ + + TA R Q L +RS H R +VNRAYPLP RA Sbjct: 360 IEAANERPKEPRITSRHQTAYRYGQPPLHHRSSLHPRNDVNRAYPLPKRA 409