BLASTX nr result
ID: Mentha28_contig00018103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00018103 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200954.1| hypothetical protein PRUPE_ppa001507mg [Prun... 62 1e-07 gb|EPS60611.1| hypothetical protein M569_14192, partial [Genlise... 61 2e-07 gb|EYU18371.1| hypothetical protein MIMGU_mgv1a001684mg [Mimulus... 60 2e-07 ref|XP_004292446.1| PREDICTED: K(+) efflux antiporter 3, chlorop... 59 5e-07 gb|EXB51449.1| K(+) efflux antiporter 3 [Morus notabilis] 55 8e-06 >ref|XP_007200954.1| hypothetical protein PRUPE_ppa001507mg [Prunus persica] gi|462396354|gb|EMJ02153.1| hypothetical protein PRUPE_ppa001507mg [Prunus persica] Length = 812 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%), Gaps = 1/32 (3%) Frame = -1 Query: 393 ANFLSTPLASGIDGD-VGWPFVAFDLDPSVVK 301 ANFLSTPLASGIDGD +GWPF+AFDLDPSVVK Sbjct: 551 ANFLSTPLASGIDGDNLGWPFIAFDLDPSVVK 582 >gb|EPS60611.1| hypothetical protein M569_14192, partial [Genlisea aurea] Length = 295 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 393 ANFLSTPLASGIDGDVGWPFVAFDLDPSVVK 301 ANFLSTPLASGID D GWP+VAFDLDP VVK Sbjct: 211 ANFLSTPLASGIDSDAGWPYVAFDLDPCVVK 241 >gb|EYU18371.1| hypothetical protein MIMGU_mgv1a001684mg [Mimulus guttatus] Length = 773 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 393 ANFLSTPLASGIDGDVGWPFVAFDLDPSVVK 301 ANFLSTPLASGIDGD GWP+VAFDLD SVVK Sbjct: 540 ANFLSTPLASGIDGDSGWPYVAFDLDLSVVK 570 >ref|XP_004292446.1| PREDICTED: K(+) efflux antiporter 3, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 819 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 31/32 (96%), Gaps = 1/32 (3%) Frame = -1 Query: 393 ANFLSTPLASGIDGD-VGWPFVAFDLDPSVVK 301 ANFLSTPLASGIDGD +GWP+VAFDLDPSVV+ Sbjct: 552 ANFLSTPLASGIDGDALGWPYVAFDLDPSVVE 583 >gb|EXB51449.1| K(+) efflux antiporter 3 [Morus notabilis] Length = 818 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -1 Query: 393 ANFLSTPLASGIDGD-VGWPFVAFDLDPSVVK 301 ANFLS+PLA G+DGD V WP+VAFDLDPSVVK Sbjct: 550 ANFLSSPLAVGVDGDLVAWPYVAFDLDPSVVK 581