BLASTX nr result
ID: Mentha28_contig00018075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00018075 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22459.1| hypothetical protein MIMGU_mgv1a017102mg [Mimulus... 66 6e-09 gb|EYU28650.1| hypothetical protein MIMGU_mgv11b023676mg [Mimulu... 57 2e-06 >gb|EYU22459.1| hypothetical protein MIMGU_mgv1a017102mg [Mimulus guttatus] Length = 93 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/75 (45%), Positives = 42/75 (56%) Frame = +1 Query: 1 PTRLGGAPPTLSDKVGHTFGKTKEVASAGFGKTKAVASVGFEKSXXXXXXXXXXXXXXFN 180 P G + P LS K+ F +TKEVAS GF KTK V + GFEK+ N Sbjct: 19 PPVTGSSNPKLSKKMSEKFERTKEVASTGFEKTKVVTAAGFEKTKVAAKKVKDGASVGVN 78 Query: 181 WIRLKYKKSKLARRK 225 WI+LKY KSKL ++K Sbjct: 79 WIKLKYNKSKLFQKK 93 >gb|EYU28650.1| hypothetical protein MIMGU_mgv11b023676mg [Mimulus guttatus] Length = 115 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = +2 Query: 44 SATRSGRPRRWLRPASGKPRRWLPSASRNPRWRPGKSRSAPPSDSIGSGSSTRRANSPGE 223 SA S RRWL PAS K R WL SR PR +S++APP S GS S+T RA S Sbjct: 34 SARSSVGQRRWLPPASTKRRLWLLRGSRKPRSPRRRSKTAPPPASTGSNSNTTRARSSRR 93 Query: 224 SRSD 235 S+S+ Sbjct: 94 SKSE 97