BLASTX nr result
ID: Mentha28_contig00017264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00017264 (535 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35618.1| hypothetical protein MIMGU_mgv1a017467mg [Mimulus... 55 8e-06 >gb|EYU35618.1| hypothetical protein MIMGU_mgv1a017467mg [Mimulus guttatus] Length = 73 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 307 KSVDSGPASLDKGRFAPKFDGLRFIETLITAHR 209 KSV+S P S +KG+FAPK+DGL+FIETLITAHR Sbjct: 41 KSVNSPPISSEKGKFAPKYDGLKFIETLITAHR 73