BLASTX nr result
ID: Mentha28_contig00017163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00017163 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25947.1| hypothetical protein MIMGU_mgv1a005415mg [Mimulus... 58 1e-06 >gb|EYU25947.1| hypothetical protein MIMGU_mgv1a005415mg [Mimulus guttatus] Length = 484 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -2 Query: 175 MSLTIRLQHV------SSASTAITTIKKSGYTTKFHSETIYHSNPLAPLVFSH-KKIQSL 17 MSLTI+LQHV + +T T IKK+ TK HS+ IYH+NPL+PL + +K+QSL Sbjct: 1 MSLTIKLQHVVNNTHVNPTTTTATAIKKTRSATKLHSKPIYHTNPLSPLALTRTRKMQSL 60 Query: 16 PK 11 P+ Sbjct: 61 PR 62