BLASTX nr result
ID: Mentha28_contig00017103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00017103 (899 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29351.1| hypothetical protein MIMGU_mgv1a023006mg [Mimulus... 59 3e-06 gb|EYU31767.1| hypothetical protein MIMGU_mgv1a023969mg [Mimulus... 58 4e-06 >gb|EYU29351.1| hypothetical protein MIMGU_mgv1a023006mg [Mimulus guttatus] Length = 251 Score = 58.5 bits (140), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 120 MGNTVGSIFNGVGQVIGKIMGHPLDFLSGKSCNAL 16 MGN GS F G+GQV+G I+GHPLDFLSGKSC+++ Sbjct: 1 MGNATGSFFAGLGQVVGNILGHPLDFLSGKSCDSV 35 >gb|EYU31767.1| hypothetical protein MIMGU_mgv1a023969mg [Mimulus guttatus] Length = 242 Score = 58.2 bits (139), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 120 MGNTVGSIFNGVGQVIGKIMGHPLDFLSGKSCNAL 16 MGN GS F G+GQV+G I+GHPLDFLSGKSC+++ Sbjct: 1 MGNATGSFFAGLGQVLGNILGHPLDFLSGKSCDSV 35