BLASTX nr result
ID: Mentha28_contig00017075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00017075 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43419.1| hypothetical protein MIMGU_mgv1a003457mg [Mimulus... 59 7e-07 >gb|EYU43419.1| hypothetical protein MIMGU_mgv1a003457mg [Mimulus guttatus] Length = 584 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -2 Query: 383 MQKMAIFQRFSRTFRENSLLTKAMNSFTISGGDLMAYPRAKSGNGMNVFNAIAAESK 213 M+KM +FQRFSRTFR+N L K + FT+SGG L+AY AK+ G++ N + K Sbjct: 1 MRKMTVFQRFSRTFRDNPSLGKMLIVFTVSGGGLVAYSEAKADGGIHAVNPSEVDVK 57