BLASTX nr result
ID: Mentha28_contig00016555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00016555 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33880.1| hypothetical protein MIMGU_mgv1a011838mg [Mimulus... 105 7e-21 ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed b... 105 7e-21 emb|CBI23205.3| unnamed protein product [Vitis vinifera] 105 7e-21 gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] 104 1e-20 ref|XP_007026147.1| Pyridoxal phosphate-dependent enzyme [Theobr... 103 3e-20 ref|XP_006467399.1| PREDICTED: proline synthase co-transcribed b... 102 6e-20 ref|XP_007211915.1| hypothetical protein PRUPE_ppa010528mg [Prun... 102 6e-20 ref|XP_006417285.1| hypothetical protein EUTSA_v10008483mg [Eutr... 100 2e-19 ref|NP_849649.1| putative pyridoxal phosphate-dependent enzyme, ... 100 2e-19 ref|NP_001190850.1| putative pyridoxal phosphate-dependent enzym... 100 2e-19 ref|NP_567760.4| putative pyridoxal phosphate-dependent enzyme, ... 100 2e-19 ref|XP_006449777.1| hypothetical protein CICLE_v10016262mg [Citr... 100 3e-19 ref|XP_006383876.1| hypothetical protein POPTR_0004s00800g [Popu... 99 5e-19 ref|XP_002867537.1| AT4g26860/F10M23_200 [Arabidopsis lyrata sub... 99 7e-19 ref|XP_006348146.1| PREDICTED: proline synthase co-transcribed b... 99 9e-19 ref|XP_004232692.1| PREDICTED: proline synthase co-transcribed b... 99 9e-19 ref|XP_007146512.1| hypothetical protein PHAVU_006G047100g [Phas... 98 1e-18 ref|XP_006304144.1| hypothetical protein CARUB_v10010142mg [Caps... 98 1e-18 ref|XP_002518437.1| proline synthetase associated protein, putat... 98 1e-18 ref|XP_004960273.1| PREDICTED: proline synthase co-transcribed b... 97 2e-18 >gb|EYU33880.1| hypothetical protein MIMGU_mgv1a011838mg [Mimulus guttatus] Length = 269 Score = 105 bits (262), Expect = 7e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCR+E+CKALGI EEQ ELSMGMSGDFELAVEMGSTNVR+GSTIFGAREYPKK Sbjct: 215 LANCRTEVCKALGIAEEQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPKK 269 >ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Vitis vinifera] Length = 264 Score = 105 bits (262), Expect = 7e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCRSE+CK+LGI EEQ ELSMGMSGDFELA+EMGSTNVRIGSTIFGAREYPKK Sbjct: 207 LANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 261 >emb|CBI23205.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 105 bits (262), Expect = 7e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCRSE+CK+LGI EEQ ELSMGMSGDFELA+EMGSTNVRIGSTIFGAREYPKK Sbjct: 254 LANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 308 >gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] Length = 316 Score = 104 bits (260), Expect = 1e-20 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCRSE+CKALGI EEQ ELSMGMSGDFELA+EMGSTNVRIGSTIFG REYPKK Sbjct: 260 LANCRSEVCKALGIAEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYPKK 314 >ref|XP_007026147.1| Pyridoxal phosphate-dependent enzyme [Theobroma cacao] gi|508781513|gb|EOY28769.1| Pyridoxal phosphate-dependent enzyme [Theobroma cacao] Length = 266 Score = 103 bits (257), Expect = 3e-20 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCRSE+CKALGI EEQ ELSMGMSGDFE A+EMGSTNVRIGSTIFGAREYPKK Sbjct: 211 LANCRSEVCKALGIPEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGAREYPKK 265 >ref|XP_006467399.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Citrus sinensis] Length = 269 Score = 102 bits (254), Expect = 6e-20 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LA CRSE+CKALGI EEQ +LSMGMSGDFELA+EMGSTNVRIGSTIFGAREYPKK Sbjct: 214 LAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 268 >ref|XP_007211915.1| hypothetical protein PRUPE_ppa010528mg [Prunus persica] gi|462407780|gb|EMJ13114.1| hypothetical protein PRUPE_ppa010528mg [Prunus persica] Length = 246 Score = 102 bits (254), Expect = 6e-20 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK*AN 365 LANCR+E+CKALGI EEQ ELSMGMS DFELA+E+GSTNVRIGSTIFGAREYPKK +N Sbjct: 189 LANCRTEVCKALGIPEEQCELSMGMSADFELAIELGSTNVRIGSTIFGAREYPKKLSN 246 >ref|XP_006417285.1| hypothetical protein EUTSA_v10008483mg [Eutrema salsugineum] gi|557095056|gb|ESQ35638.1| hypothetical protein EUTSA_v10008483mg [Eutrema salsugineum] Length = 266 Score = 100 bits (249), Expect = 2e-19 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LA CRSE+CK LGI EEQ ELSMGMSGDFELA+E+GSTNVRIGSTIFGAREYPKK Sbjct: 211 LAKCRSEVCKELGIPEEQCELSMGMSGDFELAIELGSTNVRIGSTIFGAREYPKK 265 >ref|NP_849649.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] gi|3157934|gb|AAC17617.1| Similar to hypothetical protein F09E5.8 gb|U37429 from C. elegans. ESTs gb|T42019 and gb|N97000 come from this gene [Arabidopsis thaliana] gi|332190697|gb|AEE28818.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] Length = 255 Score = 100 bits (249), Expect = 2e-19 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LA CRSE+CK LGI EEQ ELSMGMSGDFELA+E+GSTNVRIGSTIFGAREYPKK Sbjct: 201 LAKCRSEVCKELGIPEEQCELSMGMSGDFELAIELGSTNVRIGSTIFGAREYPKK 255 >ref|NP_001190850.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] gi|332659862|gb|AEE85262.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] Length = 254 Score = 100 bits (249), Expect = 2e-19 Identities = 44/55 (80%), Positives = 53/55 (96%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 L+NCR+++CKALG+ E+Q+ELSMGMSGDFELA+EMGSTNVR+GSTIFG REYPKK Sbjct: 198 LSNCRADVCKALGMAEDQFELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKK 252 >ref|NP_567760.4| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] gi|14030629|gb|AAK52989.1|AF375405_1 AT4g26860/F10M23_200 [Arabidopsis thaliana] gi|17978899|gb|AAL47419.1| AT4g26860/F10M23_200 [Arabidopsis thaliana] gi|21536981|gb|AAM61322.1| putative proline synthetase associated protein [Arabidopsis thaliana] gi|332659861|gb|AEE85261.1| putative pyridoxal phosphate-dependent enzyme, YBL036C type [Arabidopsis thaliana] Length = 244 Score = 100 bits (249), Expect = 2e-19 Identities = 44/55 (80%), Positives = 53/55 (96%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 L+NCR+++CKALG+ E+Q+ELSMGMSGDFELA+EMGSTNVR+GSTIFG REYPKK Sbjct: 188 LSNCRADVCKALGMAEDQFELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKK 242 >ref|XP_006449777.1| hypothetical protein CICLE_v10016262mg [Citrus clementina] gi|557552388|gb|ESR63017.1| hypothetical protein CICLE_v10016262mg [Citrus clementina] Length = 269 Score = 100 bits (248), Expect = 3e-19 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LA CRSE+CKALGI EEQ +LSMGMSGDFELA+EMGSTNVRIGSTIFGAREYP K Sbjct: 214 LAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPPK 268 >ref|XP_006383876.1| hypothetical protein POPTR_0004s00800g [Populus trichocarpa] gi|550340024|gb|ERP61673.1| hypothetical protein POPTR_0004s00800g [Populus trichocarpa] Length = 272 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCRSE+CKALGI EEQ ELSMGMS DFE A+EMGSTNVRIGSTIFG REYPKK Sbjct: 217 LANCRSEVCKALGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPKK 271 >ref|XP_002867537.1| AT4g26860/F10M23_200 [Arabidopsis lyrata subsp. lyrata] gi|297313373|gb|EFH43796.1| AT4g26860/F10M23_200 [Arabidopsis lyrata subsp. lyrata] Length = 244 Score = 99.0 bits (245), Expect = 7e-19 Identities = 43/55 (78%), Positives = 53/55 (96%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 L+NCR+++CKALG+ E+++ELSMGMSGDFELA+EMGSTNVR+GSTIFG REYPKK Sbjct: 188 LSNCRADVCKALGMAEDRFELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKK 242 >ref|XP_006348146.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum tuberosum] Length = 279 Score = 98.6 bits (244), Expect = 9e-19 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK*AN 365 LA CRSE+C+ALGI E+Q +LSMGMSGDFELAVEMGSTNVR+GSTIFGAREYP K +N Sbjct: 222 LARCRSEVCEALGISEDQCDLSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPTKQSN 279 >ref|XP_004232692.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum lycopersicum] Length = 283 Score = 98.6 bits (244), Expect = 9e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LA CRSE+C+ALGI E+Q ELSMGMSGDFELAVEMGSTNVR+GSTIFGAREYP K Sbjct: 229 LAKCRSEVCEALGISEDQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPTK 283 >ref|XP_007146512.1| hypothetical protein PHAVU_006G047100g [Phaseolus vulgaris] gi|561019735|gb|ESW18506.1| hypothetical protein PHAVU_006G047100g [Phaseolus vulgaris] Length = 245 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 L+NCRSE+CKAL + EEQ ELSMGMSGDFELA+EMGSTNVR+GSTIFG REYPKK Sbjct: 189 LSNCRSEVCKALEMPEEQCELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKK 243 >ref|XP_006304144.1| hypothetical protein CARUB_v10010142mg [Capsella rubella] gi|482572855|gb|EOA37042.1| hypothetical protein CARUB_v10010142mg [Capsella rubella] Length = 241 Score = 97.8 bits (242), Expect = 1e-18 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LA CRSE+CK LGI EEQ ELSMGMSGDFELA+E+GSTNVRIGSTIFGAREYP K Sbjct: 186 LAKCRSEVCKELGIPEEQCELSMGMSGDFELAIELGSTNVRIGSTIFGAREYPLK 240 >ref|XP_002518437.1| proline synthetase associated protein, putative [Ricinus communis] gi|223542282|gb|EEF43824.1| proline synthetase associated protein, putative [Ricinus communis] Length = 270 Score = 97.8 bits (242), Expect = 1e-18 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCRSE+CK LGI EEQ ELSMGMS DFE A+EMGSTNVRIGSTIFG REYPKK Sbjct: 215 LANCRSEVCKTLGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPKK 269 >ref|XP_004960273.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Setaria italica] Length = 243 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = -2 Query: 538 LANCRSEICKALGIVEEQYELSMGMSGDFELAVEMGSTNVRIGSTIFGAREYPKK 374 LANCR E+CK LGI EEQ ELSMGMS DFE A+EMGSTNVR+GSTIFGAREYPKK Sbjct: 188 LANCRKEVCKELGIPEEQCELSMGMSADFEQAIEMGSTNVRVGSTIFGAREYPKK 242