BLASTX nr result
ID: Mentha28_contig00016405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00016405 (590 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31391.1| hypothetical protein MIMGU_mgv1a015877mg [Mimulus... 83 5e-14 >gb|EYU31391.1| hypothetical protein MIMGU_mgv1a015877mg [Mimulus guttatus] Length = 142 Score = 83.2 bits (204), Expect = 5e-14 Identities = 43/74 (58%), Positives = 53/74 (71%) Frame = +1 Query: 1 KASLASRAVTTSNEMMDVAPPEEQQGNVMDRSPRDADPSPSLSVVAGAVGQTNKAKTLLD 180 KASLAS+AV T NE MD+ PP + +D+S RDADP+PSL +G Q+ ++KTL D Sbjct: 59 KASLASKAVVTPNEKMDIVPPVKPTLKSVDQSIRDADPAPSLHKASGIEEQSKESKTLED 118 Query: 181 AVKPKHKRNKKKFS 222 AVKPKHKR KKK S Sbjct: 119 AVKPKHKRKKKKNS 132