BLASTX nr result
ID: Mentha28_contig00016100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00016100 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307023.1| ribosomal protein L17 [Populus trichocarpa] ... 68 1e-09 ref|XP_002310514.2| ribosomal protein L17 [Populus trichocarpa] ... 67 2e-09 ref|XP_006281236.1| hypothetical protein CARUB_v10027279mg [Caps... 67 3e-09 ref|NP_568992.1| large subunit ribosomal protein L17 [Arabidopsi... 66 4e-09 dbj|BAC42886.1| putative 50S ribosomal protein L17 [Arabidopsis ... 66 4e-09 dbj|BAB11432.1| 50S ribosomal protein L17 [Arabidopsis thaliana] 66 4e-09 gb|AAM63867.1| 50S ribosomal protein L17 [Arabidopsis thaliana] 66 4e-09 ref|XP_002866626.1| ribosomal protein L17 family protein [Arabid... 66 6e-09 ref|XP_006288819.1| hypothetical protein CARUB_v10002154mg [Caps... 65 7e-09 gb|EYU23795.1| hypothetical protein MIMGU_mgv1a015337mg [Mimulus... 65 1e-08 ref|XP_002873421.1| ribosomal protein L17 family protein [Arabid... 65 1e-08 gb|ACJ84008.1| unknown [Medicago truncatula] 64 2e-08 ref|XP_003602582.1| 50S ribosomal protein L17 [Medicago truncatu... 64 2e-08 ref|XP_003630831.1| 50S ribosomal protein L17 [Medicago truncatu... 64 3e-08 emb|CAB89353.1| ribsomal protein-like [Arabidopsis thaliana] 63 4e-08 ref|NP_568216.1| ribosomal protein L17 family protein [Arabidops... 63 4e-08 ref|XP_007048324.1| Ribosomal protein L17 family protein [Theobr... 63 5e-08 gb|EXB40993.1| 50S ribosomal protein L17 [Morus notabilis] 62 6e-08 ref|XP_006399460.1| hypothetical protein EUTSA_v10014895mg [Eutr... 62 6e-08 ref|NP_001237810.1| uncharacterized protein LOC100305861 [Glycin... 62 6e-08 >ref|XP_002307023.1| ribosomal protein L17 [Populus trichocarpa] gi|222856472|gb|EEE94019.1| ribosomal protein L17 [Populus trichocarpa] Length = 160 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQRAPLDPWTRSRLTRQ+APPKEEKS+D + Sbjct: 126 TPQPPQRAPLDPWTRSRLTRQFAPPKEEKSSDPE 159 >ref|XP_002310514.2| ribosomal protein L17 [Populus trichocarpa] gi|550334094|gb|EEE90964.2| ribosomal protein L17 [Populus trichocarpa] Length = 160 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQRAP+DPWTRSRLTRQ+APPKEEKS+D + Sbjct: 126 TPQPPQRAPMDPWTRSRLTRQFAPPKEEKSSDPE 159 >ref|XP_006281236.1| hypothetical protein CARUB_v10027279mg [Capsella rubella] gi|482549940|gb|EOA14134.1| hypothetical protein CARUB_v10027279mg [Capsella rubella] Length = 160 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PP R PLDPW RSRLTRQYAPPKEEKS+DSD Sbjct: 126 TPQPPPRVPLDPWERSRLTRQYAPPKEEKSSDSD 159 >ref|NP_568992.1| large subunit ribosomal protein L17 [Arabidopsis thaliana] gi|107738052|gb|ABF83622.1| At5g64650 [Arabidopsis thaliana] gi|332010549|gb|AED97932.1| large subunit ribosomal protein L17 [Arabidopsis thaliana] Length = 160 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PP R PLDPW RSRLTRQYAPPKEEK++DSD Sbjct: 126 TPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD 159 >dbj|BAC42886.1| putative 50S ribosomal protein L17 [Arabidopsis thaliana] Length = 146 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PP R PLDPW RSRLTRQYAPPKEEK++DSD Sbjct: 112 TPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD 145 >dbj|BAB11432.1| 50S ribosomal protein L17 [Arabidopsis thaliana] Length = 156 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PP R PLDPW RSRLTRQYAPPKEEK++DSD Sbjct: 122 TPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD 155 >gb|AAM63867.1| 50S ribosomal protein L17 [Arabidopsis thaliana] Length = 160 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PP R PLDPW RSRLTRQYAPPKEEK++DSD Sbjct: 126 TPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSD 159 >ref|XP_002866626.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. lyrata] gi|297312461|gb|EFH42885.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. lyrata] Length = 160 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PP R PLDPW RSRLTRQYAPPKEEKS DSD Sbjct: 126 TPQPPPRVPLDPWARSRLTRQYAPPKEEKSWDSD 159 >ref|XP_006288819.1| hypothetical protein CARUB_v10002154mg [Capsella rubella] gi|482557525|gb|EOA21717.1| hypothetical protein CARUB_v10002154mg [Capsella rubella] Length = 160 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQR PLDPW RSRLTRQ+APPKEEK++DS+ Sbjct: 126 TPQPPQRVPLDPWARSRLTRQFAPPKEEKTSDSE 159 >gb|EYU23795.1| hypothetical protein MIMGU_mgv1a015337mg [Mimulus guttatus] Length = 160 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSDS 299 TP PPQRA +DPWTRSRLTRQ APPKEE+S DSD+ Sbjct: 126 TPQPPQRAAIDPWTRSRLTRQMAPPKEERSTDSDN 160 >ref|XP_002873421.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. lyrata] gi|297319258|gb|EFH49680.1| ribosomal protein L17 family protein [Arabidopsis lyrata subsp. lyrata] Length = 160 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQR PLDPW RSRLT+Q+APPKEEKS+DS+ Sbjct: 126 TPQPPQRVPLDPWERSRLTKQFAPPKEEKSSDSE 159 >gb|ACJ84008.1| unknown [Medicago truncatula] Length = 162 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSDS 299 TP PPQR PLDPWTRSRLTRQ+APPK EKS DSDS Sbjct: 126 TPQPPQRTPLDPWTRSRLTRQFAPPKVEKS-DSDS 159 >ref|XP_003602582.1| 50S ribosomal protein L17 [Medicago truncatula] gi|355491630|gb|AES72833.1| 50S ribosomal protein L17 [Medicago truncatula] gi|388522235|gb|AFK49179.1| unknown [Medicago truncatula] Length = 162 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSDS 299 TP PPQR PLDPWTRSRLTRQ+APPK EKS DSDS Sbjct: 126 TPQPPQRTPLDPWTRSRLTRQFAPPKVEKS-DSDS 159 >ref|XP_003630831.1| 50S ribosomal protein L17 [Medicago truncatula] gi|355524853|gb|AET05307.1| 50S ribosomal protein L17 [Medicago truncatula] Length = 438 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSDS 299 TP PPQRAPLDPWTRS LTRQ+APPK EKS DSDS Sbjct: 402 TPQPPQRAPLDPWTRSHLTRQFAPPKGEKS-DSDS 435 >emb|CAB89353.1| ribsomal protein-like [Arabidopsis thaliana] Length = 156 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQR PLDPW RSRLTRQ+APPKEEK DS+ Sbjct: 122 TPQPPQRVPLDPWERSRLTRQFAPPKEEKIPDSE 155 >ref|NP_568216.1| ribosomal protein L17 family protein [Arabidopsis thaliana] gi|21592350|gb|AAM64301.1| ribsomal protein-like [Arabidopsis thaliana] gi|27808520|gb|AAO24540.1| At5g09770 [Arabidopsis thaliana] gi|110736202|dbj|BAF00072.1| ribsomal protein - like [Arabidopsis thaliana] gi|332004061|gb|AED91444.1| ribosomal protein L17 family protein [Arabidopsis thaliana] Length = 160 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQR PLDPW RSRLTRQ+APPKEEK DS+ Sbjct: 126 TPQPPQRVPLDPWERSRLTRQFAPPKEEKIPDSE 159 >ref|XP_007048324.1| Ribosomal protein L17 family protein [Theobroma cacao] gi|508700585|gb|EOX92481.1| Ribosomal protein L17 family protein [Theobroma cacao] Length = 160 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQRAPLDPWT+SRL+RQ+APPKEEK+++ + Sbjct: 126 TPQPPQRAPLDPWTKSRLSRQFAPPKEEKNSEPE 159 >gb|EXB40993.1| 50S ribosomal protein L17 [Morus notabilis] Length = 154 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQR P+DPWTRS+L RQYAPPKEEKS++ + Sbjct: 120 TPQPPQRPPMDPWTRSKLCRQYAPPKEEKSSEDE 153 >ref|XP_006399460.1| hypothetical protein EUTSA_v10014895mg [Eutrema salsugineum] gi|557100550|gb|ESQ40913.1| hypothetical protein EUTSA_v10014895mg [Eutrema salsugineum] Length = 160 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKSADSD 302 TP PPQR PLDPW +SRL +QYAPPKEEK++DS+ Sbjct: 126 TPQPPQRVPLDPWAKSRLMKQYAPPKEEKTSDSE 159 >ref|NP_001237810.1| uncharacterized protein LOC100305861 [Glycine max] gi|255626807|gb|ACU13748.1| unknown [Glycine max] Length = 159 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 403 TPPPPQRAPLDPWTRSRLTRQYAPPKEEKS 314 TP PPQRAPLDPWTRSRL+RQ+APPKE+KS Sbjct: 126 TPQPPQRAPLDPWTRSRLSRQFAPPKEDKS 155