BLASTX nr result
ID: Mentha28_contig00016006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00016006 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23856.1| hypothetical protein MIMGU_mgv1a010667mg [Mimulus... 84 2e-14 gb|EYU32488.1| hypothetical protein MIMGU_mgv1a025266mg [Mimulus... 74 2e-11 ref|XP_004231607.1| PREDICTED: BTB/POZ domain-containing protein... 57 2e-06 ref|XP_006363604.1| PREDICTED: BTB/POZ domain-containing protein... 57 4e-06 >gb|EYU23856.1| hypothetical protein MIMGU_mgv1a010667mg [Mimulus guttatus] Length = 305 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/79 (56%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +3 Query: 159 MKCQSCKEDYGDRDAGTCRECYVXXXXXXXXXXXXXXXXXXXVNFLRLLC-----NGPNS 323 MKC SCKEDYGD DAGTCRECY VNFLRLL GPN Sbjct: 51 MKCLSCKEDYGDNDAGTCRECYEEAGETEEELKREIDDLKSKVNFLRLLSVGPGPVGPNC 110 Query: 324 MTRVNNPCFSDVVLVACGS 380 +TR N PCFSDVVLVA GS Sbjct: 111 ITRPNTPCFSDVVLVASGS 129 >gb|EYU32488.1| hypothetical protein MIMGU_mgv1a025266mg [Mimulus guttatus] Length = 249 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/75 (49%), Positives = 41/75 (54%) Frame = +3 Query: 159 MKCQSCKEDYGDRDAGTCRECYVXXXXXXXXXXXXXXXXXXXVNFLRLLCNGPNSMTRVN 338 MKC SCKE+YGDR+AGTCRECY VNFL L+ P + N Sbjct: 1 MKCLSCKEEYGDRNAGTCRECYEEAGETEEELKRQIVELDSKVNFLSLIAISPKFVPTAN 60 Query: 339 NPCFSDVVLVACGSP 383 CFSDVVLVA G P Sbjct: 61 PRCFSDVVLVASGPP 75 >ref|XP_004231607.1| PREDICTED: BTB/POZ domain-containing protein At4g08455-like [Solanum lycopersicum] Length = 279 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/72 (44%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 159 MKCQSCKEDYGDRDAGTCRECYVXXXXXXXXXXXXXXXXXXXVNFLRLLCNGPN-SMTRV 335 MKC SCKEDYG DAGTCRECY VNFLR + + Sbjct: 31 MKCVSCKEDYGSSDAGTCRECYEEASETEEELKREIEDLKAKVNFLRFWSPSQHLHQQQR 90 Query: 336 NNPCFSDVVLVA 371 P FSD+VLVA Sbjct: 91 TTPFFSDIVLVA 102 >ref|XP_006363604.1| PREDICTED: BTB/POZ domain-containing protein At4g08455-like [Solanum tuberosum] Length = 279 Score = 56.6 bits (135), Expect = 4e-06 Identities = 32/72 (44%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 159 MKCQSCKEDYGDRDAGTCRECYVXXXXXXXXXXXXXXXXXXXVNFLRLLCNGPNSMTRVN 338 MKC SCKEDY RDAGTCRECY VNFLR + + Sbjct: 31 MKCVSCKEDYSSRDAGTCRECYEEASETEEELKREIEDLKAKVNFLRFWSPSQHLHQQQR 90 Query: 339 N-PCFSDVVLVA 371 P FSD+VLVA Sbjct: 91 TVPFFSDIVLVA 102