BLASTX nr result
ID: Mentha28_contig00015961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00015961 (703 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004310283.1| PREDICTED: calpain-A-like [Fragaria vesca su... 88 3e-15 ref|XP_004294954.1| PREDICTED: uncharacterized protein LOC101315... 88 3e-15 ref|XP_007208412.1| hypothetical protein PRUPE_ppa000045mg [Prun... 88 3e-15 ref|XP_002523419.1| calpain, putative [Ricinus communis] gi|2235... 88 3e-15 ref|XP_002299263.2| hypothetical protein POPTR_0001s04110g [Popu... 87 4e-15 gb|EYU39270.1| hypothetical protein MIMGU_mgv1a000044mg [Mimulus... 87 5e-15 gb|EYU25999.1| hypothetical protein MIMGU_mgv1a023650mg [Mimulus... 87 5e-15 ref|XP_006392645.1| hypothetical protein EUTSA_v10011175mg [Eutr... 86 1e-14 ref|XP_006303131.1| hypothetical protein CARUB_v10008068mg [Caps... 86 1e-14 gb|AAG51565.1|AC027034_11 n-calpain-1 large subunit, putative; 1... 86 1e-14 ref|NP_001185238.1| calpain-type cysteine protease DEK1 [Arabido... 86 1e-14 ref|XP_002894501.1| hypothetical protein ARALYDRAFT_892532 [Arab... 86 1e-14 ref|XP_002285732.1| PREDICTED: uncharacterized protein LOC100244... 86 1e-14 emb|CAN78877.1| hypothetical protein VITISV_024988 [Vitis vinifera] 86 1e-14 ref|NP_175932.2| calpain-type cysteine protease DEK1 [Arabidopsi... 86 1e-14 gb|AAL67128.1| putative n-calpain-1 large subunit [Arabidopsis t... 86 1e-14 ref|XP_006488938.1| PREDICTED: calpain-type cysteine protease DE... 86 2e-14 ref|XP_006445587.1| hypothetical protein CICLE_v10014012mg [Citr... 86 2e-14 ref|XP_006580217.1| PREDICTED: calpain-type cysteine protease DE... 85 3e-14 ref|XP_006367593.1| PREDICTED: calpain-type cysteine protease DE... 85 3e-14 >ref|XP_004310283.1| PREDICTED: calpain-A-like [Fragaria vesca subsp. vesca] Length = 324 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SITLEAL Sbjct: 282 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASITLEAL 323 >ref|XP_004294954.1| PREDICTED: uncharacterized protein LOC101315416 [Fragaria vesca subsp. vesca] Length = 2161 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SITLEAL Sbjct: 2119 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASITLEAL 2160 >ref|XP_007208412.1| hypothetical protein PRUPE_ppa000045mg [Prunus persica] gi|595842412|ref|XP_007208413.1| hypothetical protein PRUPE_ppa000045mg [Prunus persica] gi|462404054|gb|EMJ09611.1| hypothetical protein PRUPE_ppa000045mg [Prunus persica] gi|462404055|gb|EMJ09612.1| hypothetical protein PRUPE_ppa000045mg [Prunus persica] Length = 2160 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SITLEAL Sbjct: 2119 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASITLEAL 2160 >ref|XP_002523419.1| calpain, putative [Ricinus communis] gi|223537369|gb|EEF38998.1| calpain, putative [Ricinus communis] Length = 2158 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SITLEAL Sbjct: 2117 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASITLEAL 2158 >ref|XP_002299263.2| hypothetical protein POPTR_0001s04110g [Populus trichocarpa] gi|550346477|gb|EEE84068.2| hypothetical protein POPTR_0001s04110g [Populus trichocarpa] Length = 2123 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+S+TLEAL Sbjct: 2082 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASVTLEAL 2123 >gb|EYU39270.1| hypothetical protein MIMGU_mgv1a000044mg [Mimulus guttatus] Length = 2149 Score = 87.0 bits (214), Expect = 5e-15 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSI LEAL Sbjct: 2108 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSIVLEAL 2149 >gb|EYU25999.1| hypothetical protein MIMGU_mgv1a023650mg [Mimulus guttatus] Length = 2155 Score = 87.0 bits (214), Expect = 5e-15 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSI LEAL Sbjct: 2114 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSIVLEAL 2155 >ref|XP_006392645.1| hypothetical protein EUTSA_v10011175mg [Eutrema salsugineum] gi|557089223|gb|ESQ29931.1| hypothetical protein EUTSA_v10011175mg [Eutrema salsugineum] Length = 2152 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2111 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2152 >ref|XP_006303131.1| hypothetical protein CARUB_v10008068mg [Capsella rubella] gi|482571842|gb|EOA36029.1| hypothetical protein CARUB_v10008068mg [Capsella rubella] Length = 2152 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2111 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2152 >gb|AAG51565.1|AC027034_11 n-calpain-1 large subunit, putative; 13921-23959 [Arabidopsis thaliana] Length = 2143 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2102 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2143 >ref|NP_001185238.1| calpain-type cysteine protease DEK1 [Arabidopsis thaliana] gi|332195115|gb|AEE33236.1| calpain-type cysteine protease [Arabidopsis thaliana] Length = 2179 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2138 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2179 >ref|XP_002894501.1| hypothetical protein ARALYDRAFT_892532 [Arabidopsis lyrata subsp. lyrata] gi|297340343|gb|EFH70760.1| hypothetical protein ARALYDRAFT_892532 [Arabidopsis lyrata subsp. lyrata] Length = 2151 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2110 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2151 >ref|XP_002285732.1| PREDICTED: uncharacterized protein LOC100244915 [Vitis vinifera] gi|297746484|emb|CBI16540.3| unnamed protein product [Vitis vinifera] Length = 2159 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVL+PDPKGYTIVPTTIHPGEEAPFVLSVFTK+S+TLEAL Sbjct: 2118 CEMVLEPDPKGYTIVPTTIHPGEEAPFVLSVFTKASVTLEAL 2159 >emb|CAN78877.1| hypothetical protein VITISV_024988 [Vitis vinifera] Length = 1508 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVL+PDPKGYTIVPTTIHPGEEAPFVLSVFTK+S+TLEAL Sbjct: 1467 CEMVLEPDPKGYTIVPTTIHPGEEAPFVLSVFTKASVTLEAL 1508 >ref|NP_175932.2| calpain-type cysteine protease DEK1 [Arabidopsis thaliana] gi|30695926|ref|NP_850965.1| calpain-type cysteine protease DEK1 [Arabidopsis thaliana] gi|30695928|ref|NP_850966.1| calpain-type cysteine protease DEK1 [Arabidopsis thaliana] gi|30695930|ref|NP_850967.1| calpain-type cysteine protease DEK1 [Arabidopsis thaliana] gi|75247544|sp|Q8RVL2.1|DEK1_ARATH RecName: Full=Calpain-type cysteine protease DEK1; AltName: Full=Phytocalpain DEK1; AltName: Full=Protein DEFECTIVE KERNEL 1; Short=AtDEK1; AltName: Full=Protein EMBRYO DEFECTIVE 1275; AltName: Full=Protein EMBRYO DEFECTIVE 80; Flags: Precursor gi|20268660|gb|AAL38186.1| calpain-like protein [Arabidopsis thaliana] gi|332195111|gb|AEE33232.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195112|gb|AEE33233.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195113|gb|AEE33234.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195114|gb|AEE33235.1| calpain-type cysteine protease [Arabidopsis thaliana] Length = 2151 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2110 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2151 >gb|AAL67128.1| putative n-calpain-1 large subunit [Arabidopsis thaliana] Length = 549 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 508 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 549 >ref|XP_006488938.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X1 [Citrus sinensis] gi|568871535|ref|XP_006488939.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X2 [Citrus sinensis] gi|568871537|ref|XP_006488940.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X3 [Citrus sinensis] Length = 2161 Score = 85.5 bits (210), Expect = 2e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2120 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIILEAL 2161 >ref|XP_006445587.1| hypothetical protein CICLE_v10014012mg [Citrus clementina] gi|557548198|gb|ESR58827.1| hypothetical protein CICLE_v10014012mg [Citrus clementina] Length = 2091 Score = 85.5 bits (210), Expect = 2e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI LEAL Sbjct: 2050 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASIILEAL 2091 >ref|XP_006580217.1| PREDICTED: calpain-type cysteine protease DEK1-like [Glycine max] Length = 2150 Score = 84.7 bits (208), Expect = 3e-14 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVL+P+PKGYTIVPTTIHPGEEAPFVLSVFTK+SITLEAL Sbjct: 2109 CEMVLEPEPKGYTIVPTTIHPGEEAPFVLSVFTKASITLEAL 2150 >ref|XP_006367593.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X1 [Solanum tuberosum] gi|565404325|ref|XP_006367594.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X2 [Solanum tuberosum] Length = 2142 Score = 84.7 bits (208), Expect = 3e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 701 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKSSITLEAL 576 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTK+SI+LE L Sbjct: 2101 CEMVLDPDPKGYTIVPTTIHPGEEAPFVLSVFTKASISLETL 2142