BLASTX nr result
ID: Mentha28_contig00015522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00015522 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43883.1| hypothetical protein MIMGU_mgv1a008684mg [Mimulus... 63 4e-08 >gb|EYU43883.1| hypothetical protein MIMGU_mgv1a008684mg [Mimulus guttatus] Length = 365 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/46 (67%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -3 Query: 374 KETLKQDLAMSSQKSGM-RKVQVGFPPLFVCMVALVSLIIGIMFRA 240 KE LKQ+LA+S KS R++QVGFPPLFVCMVAL+SL++G +FRA Sbjct: 320 KEKLKQELAISKTKSPTARRIQVGFPPLFVCMVALISLVMGSLFRA 365