BLASTX nr result
ID: Mentha28_contig00014058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00014058 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial... 56 5e-06 >gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial [Mimulus guttatus] Length = 442 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/75 (41%), Positives = 50/75 (66%), Gaps = 2/75 (2%) Frame = -1 Query: 221 SSDYKFLKELTLENLAVTGEAVELFVHNSPLLERLTLNVSLR-SNLVITGGTFNHFEIRC 45 S +++ LKEL+L+++ VT EAVE F+HN PLLE+L ++ + + SNL + G + + Sbjct: 160 SVNFRSLKELSLKSVIVTREAVEFFLHNCPLLEKLVVSYTCQLSNLEVCGSSLALKHLEL 219 Query: 44 RESYDI-LIKVSAPN 3 + Y + +KVSAPN Sbjct: 220 KHCYGLKSVKVSAPN 234