BLASTX nr result
ID: Mentha28_contig00014026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00014026 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263645.2| PREDICTED: uncharacterized protein LOC100261... 62 1e-07 ref|XP_002316146.2| hypothetical protein POPTR_0010s17850g [Popu... 59 1e-06 gb|EYU27567.1| hypothetical protein MIMGU_mgv1a008097mg [Mimulus... 56 7e-06 ref|XP_003570102.1| PREDICTED: uncharacterized protein LOC100846... 56 7e-06 gb|EXB53851.1| hypothetical protein L484_006771 [Morus notabilis] 55 9e-06 >ref|XP_002263645.2| PREDICTED: uncharacterized protein LOC100261626 [Vitis vinifera] gi|297736143|emb|CBI24181.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 551 YNLLKLHKNAHRAAFVALENGGELSVVIRRIEEAMSST 438 YNLLK HK+AHRAA ALE+GG LSVVIRRIEEAMSS+ Sbjct: 350 YNLLKWHKHAHRAAVKALESGGSLSVVIRRIEEAMSSS 387 >ref|XP_002316146.2| hypothetical protein POPTR_0010s17850g [Populus trichocarpa] gi|550330037|gb|EEF02317.2| hypothetical protein POPTR_0010s17850g [Populus trichocarpa] Length = 386 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 551 YNLLKLHKNAHRAAFVALENGGELSVVIRRIEEAMSS 441 +NLLK H++AHRAA ALE+GG LSVVIRRIEEAMSS Sbjct: 349 FNLLKWHRDAHRAAVKALESGGSLSVVIRRIEEAMSS 385 >gb|EYU27567.1| hypothetical protein MIMGU_mgv1a008097mg [Mimulus guttatus] Length = 385 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 551 YNLLKLHKNAHRAAFVALENGGELSVVIRRIEEAMSS 441 YNLLK K+AHRAA ALENGG LSVV+RRIEE M S Sbjct: 349 YNLLKWQKHAHRAAVKALENGGSLSVVVRRIEETMVS 385 >ref|XP_003570102.1| PREDICTED: uncharacterized protein LOC100846921 [Brachypodium distachyon] Length = 386 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 551 YNLLKLHKNAHRAAFVALENGGELSVVIRRIEEAMSS 441 YNLLK HK AHRAA ALE+G LS+VIRRIEEA+SS Sbjct: 348 YNLLKWHKKAHRAAVKALESGHSLSIVIRRIEEAISS 384 >gb|EXB53851.1| hypothetical protein L484_006771 [Morus notabilis] Length = 393 Score = 55.5 bits (132), Expect = 9e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 551 YNLLKLHKNAHRAAFVALENGGELSVVIRRIEEAMSS 441 YNLLK HKNAHRAA ALE+ LSVVIRRIEEAMS+ Sbjct: 352 YNLLKWHKNAHRAAVKALESRCSLSVVIRRIEEAMST 388