BLASTX nr result
ID: Mentha28_contig00013871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00013871 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38155.1| hypothetical protein MIMGU_mgv1a007840mg [Mimulus... 72 1e-10 ref|XP_002512005.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 dbj|BAM66423.1| calcium-sensing receptor [Nicotiana benthamiana] 55 8e-06 >gb|EYU38155.1| hypothetical protein MIMGU_mgv1a007840mg [Mimulus guttatus] Length = 393 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +3 Query: 189 ESRAEILPKEQIFSSLTQVESAIDQIREVGSNLLSGAGQVFGAVSGAVKP 338 E+RA+I PKEQI SS+TQVES IDQI+E+GS+ S AGQV GAV+ AVKP Sbjct: 60 EARAQIFPKEQIVSSITQVESTIDQIQELGSSFFSSAGQVIGAVTNAVKP 109 >ref|XP_002512005.1| conserved hypothetical protein [Ricinus communis] gi|223549185|gb|EEF50674.1| conserved hypothetical protein [Ricinus communis] Length = 400 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 198 AEILPKEQIFSSLTQVESAIDQIREVGSNLLSGAGQVFGAVSGAVKP 338 A+ LPK+QI SSLT+VE IDQ++EVGS +L A +VFG VS A+KP Sbjct: 72 AKALPKDQIVSSLTEVEKTIDQVQEVGSGILDTAQRVFGIVSDALKP 118 >dbj|BAM66423.1| calcium-sensing receptor [Nicotiana benthamiana] Length = 394 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +3 Query: 189 ESRAEILPKEQIFSSLTQVESAIDQIREVGSNLLSGAGQVFGAVSGAVKP 338 E+RA LPKE I SSL QVESA++Q +EVGSN+ A +V G V VKP Sbjct: 61 EARALSLPKEDIVSSLNQVESAVNQAQEVGSNIFDAASRVIGPVIEFVKP 110