BLASTX nr result
ID: Mentha28_contig00013701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00013701 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36392.1| hypothetical protein MIMGU_mgv1a000823mg [Mimulus... 67 3e-09 ref|XP_002320682.1| Calcium-transporting ATPase 3 family protein... 66 6e-09 ref|XP_002510078.1| cation-transporting atpase, putative [Ricinu... 65 8e-09 ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transport... 65 1e-08 ref|XP_004501511.1| PREDICTED: calcium-transporting ATPase 3, en... 64 2e-08 ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, en... 63 5e-08 ref|XP_006651781.1| PREDICTED: calcium-transporting ATPase 3, en... 62 8e-08 gb|AAO38471.1| putative P-type ATPase [Oryza sativa Japonica Group] 62 8e-08 gb|EEE59867.1| hypothetical protein OsJ_12452 [Oryza sativa Japo... 62 8e-08 gb|ABF98693.1| Calcium-transporting ATPase 3, endoplasmic reticu... 62 8e-08 emb|CBI19381.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_004290983.1| PREDICTED: calcium-transporting ATPase 3, en... 61 1e-07 ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, en... 61 2e-07 gb|ACJ86234.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, en... 60 3e-07 ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, en... 60 3e-07 ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citr... 60 3e-07 ref|XP_003524018.1| PREDICTED: calcium-transporting ATPase 3, en... 60 3e-07 gb|EEC76121.1| hypothetical protein OsI_13389 [Oryza sativa Indi... 60 4e-07 ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [A... 59 7e-07 >gb|EYU36392.1| hypothetical protein MIMGU_mgv1a000823mg [Mimulus guttatus] Length = 971 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLSFPVI+IDEILKFFSR+ G RFN R RR+DLLPK+EV Sbjct: 929 YLSFPVILIDEILKFFSRNPTGLRFNFRFRRTDLLPKQEV 968 >ref|XP_002320682.1| Calcium-transporting ATPase 3 family protein [Populus trichocarpa] gi|222861455|gb|EEE98997.1| Calcium-transporting ATPase 3 family protein [Populus trichocarpa] Length = 1015 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLSFPVIIIDEILKFFSR+S G R LR RR DLLPKRE+ Sbjct: 973 YLSFPVIIIDEILKFFSRNSTGLRLGLRFRRPDLLPKREL 1012 >ref|XP_002510078.1| cation-transporting atpase, putative [Ricinus communis] gi|223550779|gb|EEF52265.1| cation-transporting atpase, putative [Ricinus communis] Length = 987 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKRE 296 YLSFPVIIIDEILKFFSR++ G RF R RR DLLPKRE Sbjct: 945 YLSFPVIIIDEILKFFSRNANGIRFRFRFRRPDLLPKRE 983 >ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] gi|508723793|gb|EOY15690.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] Length = 1001 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLSFPVIIIDE+LKFFSR+S G RFN R RR D LPK+E+ Sbjct: 959 YLSFPVIIIDEVLKFFSRNSYGIRFNFRFRRFDALPKKEL 998 >ref|XP_004501511.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Cicer arietinum] Length = 1005 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLS PVIIIDEILKFFSR+ G RF L RRSDLLPKREV Sbjct: 963 YLSLPVIIIDEILKFFSRNPNGLRFRLWFRRSDLLPKREV 1002 >ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Solanum lycopersicum] Length = 1000 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLSFPVI+IDEILKFFSR S G RF+ R RR+DLLPKRE+ Sbjct: 959 YLSFPVILIDEILKFFSRHS-GIRFSFRFRRADLLPKREI 997 >ref|XP_006651781.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Oryza brachyantha] Length = 1000 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPK 302 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK Sbjct: 959 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK 995 >gb|AAO38471.1| putative P-type ATPase [Oryza sativa Japonica Group] Length = 747 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPK 302 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK Sbjct: 706 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK 742 >gb|EEE59867.1| hypothetical protein OsJ_12452 [Oryza sativa Japonica Group] Length = 1082 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPK 302 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK Sbjct: 1041 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK 1077 >gb|ABF98693.1| Calcium-transporting ATPase 3, endoplasmic reticulum-type, putative, expressed [Oryza sativa Japonica Group] Length = 1058 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPK 302 YLSFPVI+IDE+LKFFSR SRG RF LRLRR ++LPK Sbjct: 1017 YLSFPVILIDEVLKFFSRSSRGRRFPLRLRRREILPK 1053 >emb|CBI19381.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPK 302 YLSFPVIIIDE+LKFFSR+S G RFN R RR D+LPK Sbjct: 959 YLSFPVIIIDEVLKFFSRNSCGTRFNFRFRRPDVLPK 995 >ref|XP_004290983.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Fragaria vesca subsp. vesca] Length = 1001 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLSFPVIIIDE+LKFFSR + G R N LRR DLLP++E+ Sbjct: 959 YLSFPVIIIDEVLKFFSRSTTGLRLNFLLRRHDLLPRKEL 998 >ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Solanum tuberosum] Length = 1000 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLSFPVI+IDEILKF SR+S G RF+ R RR+DLLPKRE+ Sbjct: 959 YLSFPVILIDEILKFVSRNS-GIRFSFRFRRADLLPKREI 997 >gb|ACJ86234.1| unknown [Medicago truncatula] Length = 413 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLS PVIIIDEILKFFSR+ G R L RR+DLLPKREV Sbjct: 371 YLSLPVIIIDEILKFFSRNPSGLRLRLWFRRTDLLPKREV 410 >ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X2 [Citrus sinensis] Length = 992 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKRE 296 YLSFPVIIIDE+LKFFSR S G RF RR D+LPK+E Sbjct: 950 YLSFPVIIIDEVLKFFSRKSSGMRFKFWFRRHDILPKKE 988 >ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Citrus sinensis] Length = 1001 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKRE 296 YLSFPVIIIDE+LKFFSR S G RF RR D+LPK+E Sbjct: 959 YLSFPVIIIDEVLKFFSRKSSGMRFKFWFRRHDILPKKE 997 >ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] gi|557535774|gb|ESR46892.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] Length = 1001 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKRE 296 YLSFPVIIIDE+LKFFSR S G RF RR D+LPK+E Sbjct: 959 YLSFPVIIIDEVLKFFSRKSSGMRFKFWFRRHDILPKKE 997 >ref|XP_003524018.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoformX1 [Glycine max] Length = 1001 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 YLS PVI+IDE+LKFFSR+ G RF L RRSDLLPK+E+ Sbjct: 959 YLSLPVIVIDEVLKFFSRNPIGLRFRLWFRRSDLLPKKEL 998 >gb|EEC76121.1| hypothetical protein OsI_13389 [Oryza sativa Indica Group] Length = 1076 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 412 YLSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPK 302 YLSFPVI+IDE+LKF SR SRG RF LRLRR ++LPK Sbjct: 1035 YLSFPVILIDEVLKFLSRSSRGRRFPLRLRRREILPK 1071 >ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] gi|548861203|gb|ERN18587.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] Length = 1001 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 409 LSFPVIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREV 293 LSFPVIIIDEILK SR+ RG RFNLR + DLLPKRE+ Sbjct: 960 LSFPVIIIDEILKLLSRNVRGRRFNLRFGKRDLLPKREI 998