BLASTX nr result
ID: Mentha28_contig00013375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00013375 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23079.3| unnamed protein product [Vitis vinifera] 63 5e-15 >emb|CBI23079.3| unnamed protein product [Vitis vinifera] Length = 86 Score = 62.8 bits (151), Expect(2) = 5e-15 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 263 MSFAIIRRDVEWEWEKSVWSFWYIYIIGSTCSLSEELLIWQKIRG 129 MSFA+I RDVE EWEKS WSF +++IGS CSLSE+L I + +RG Sbjct: 1 MSFAVIHRDVEREWEKSGWSFGSLFLIGSCCSLSEDLYICKILRG 45 Score = 43.9 bits (102), Expect(2) = 5e-15 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = -2 Query: 94 ALEYLGAYEQRSLWSTAYLKDCSL 23 A+E+LGAYEQ SLWSTA+L+DCSL Sbjct: 58 AVEHLGAYEQWSLWSTAHLEDCSL 81