BLASTX nr result
ID: Mentha28_contig00013010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00013010 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38571.1| hypothetical protein MIMGU_mgv1a006100mg [Mimulus... 91 1e-16 >gb|EYU38571.1| hypothetical protein MIMGU_mgv1a006100mg [Mimulus guttatus] Length = 457 Score = 91.3 bits (225), Expect = 1e-16 Identities = 45/74 (60%), Positives = 54/74 (72%) Frame = -1 Query: 322 YIDQITYNAGVFGSRGKNMGRWTAGNGSAGGDLDANSGTFEDYDEYSGSHTPCSPHSTLK 143 YIDQ+T NAGV SRG N+G+WT+ +GGDLD NS FEDYDEYSGSH S HS L+ Sbjct: 379 YIDQLTLNAGVLVSRGNNLGKWTS---ESGGDLDENSDMFEDYDEYSGSHRLHSNHSILQ 435 Query: 142 TFLTILSIFVFLRM 101 TF+T L IF+ L + Sbjct: 436 TFITTLIIFLLLTL 449