BLASTX nr result
ID: Mentha28_contig00012404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00012404 (571 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Sola... 104 1e-20 ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Sola... 104 1e-20 gb|AFN87703.1| clathrin heavy chain 2, partial [Nicotiana tabacum] 103 2e-20 ref|XP_003518313.1| PREDICTED: clathrin heavy chain 1-like [Glyc... 103 3e-20 ref|XP_006356463.1| PREDICTED: clathrin heavy chain 1-like [Sola... 102 5e-20 ref|XP_004235240.1| PREDICTED: clathrin heavy chain 1-like [Sola... 102 5e-20 gb|AFN87702.1| clathrin heavy chain 1, partial [Nicotiana tabacum] 102 5e-20 gb|EYU26805.1| hypothetical protein MIMGU_mgv1a000127mg [Mimulus... 102 7e-20 ref|XP_004240929.1| PREDICTED: clathrin heavy chain 1-like [Sola... 101 1e-19 ref|XP_006338824.1| PREDICTED: clathrin heavy chain 1-like [Sola... 101 2e-19 ref|XP_002276855.1| PREDICTED: clathrin heavy chain 2 [Vitis vin... 101 2e-19 gb|AAG50828.1|AC074395_2 clathrin heavy chain, putative [Arabido... 100 2e-19 ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana] gi... 100 2e-19 dbj|BAD94884.1| hypothetical protein [Arabidopsis thaliana] 100 2e-19 gb|AAM19776.1| AT3g08530/T8G24_1 [Arabidopsis thaliana] gi|21928... 100 2e-19 gb|AAF01510.1|AC009991_6 putative clathrin heavy chain [Arabidop... 100 3e-19 ref|NP_187724.2| Clathrin, heavy chain [Arabidopsis thaliana] gi... 100 3e-19 ref|XP_002884831.1| hypothetical protein ARALYDRAFT_478454 [Arab... 100 3e-19 ref|XP_002884683.1| hypothetical protein ARALYDRAFT_896987 [Arab... 100 3e-19 ref|XP_002528311.1| clathrin heavy chain, putative [Ricinus comm... 100 3e-19 >ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum] Length = 1707 Score = 104 bits (260), Expect = 1e-20 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA KE KAK+NEEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELIKDKIEAQKEAKAKENEEKDVMKQQNMYAQLLPLAL 1663 >ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum] Length = 1706 Score = 104 bits (260), Expect = 1e-20 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA KE KAK+NEEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELIKDKIEAQKEAKAKENEEKDVMKQQNMYAQLLPLAL 1663 >gb|AFN87703.1| clathrin heavy chain 2, partial [Nicotiana tabacum] Length = 404 Score = 103 bits (258), Expect = 2e-20 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA E KAK+NEEKDVIKQQNMYAQLLPLAL Sbjct: 307 FAFPYLLQFIREYTGKVDELIKDKIEAQSEAKAKENEEKDVIKQQNMYAQLLPLAL 362 >ref|XP_003518313.1| PREDICTED: clathrin heavy chain 1-like [Glycine max] Length = 1706 Score = 103 bits (257), Expect = 3e-20 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA KEEKAK+ EEKDVI QQNMYAQLLPLAL Sbjct: 1607 FAFPYLLQFIREYTGKVDELIKDKIEAQKEEKAKEKEEKDVIAQQNMYAQLLPLAL 1662 >ref|XP_006356463.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum] Length = 1699 Score = 102 bits (255), Expect = 5e-20 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA E KAK+NEEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELIKDKIEAQSEAKAKENEEKDVMKQQNMYAQLLPLAL 1663 >ref|XP_004235240.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum] Length = 1702 Score = 102 bits (255), Expect = 5e-20 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA E KAK+NEEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELIKDKIEAQSEAKAKENEEKDVMKQQNMYAQLLPLAL 1663 >gb|AFN87702.1| clathrin heavy chain 1, partial [Nicotiana tabacum] Length = 404 Score = 102 bits (255), Expect = 5e-20 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA E KAK+NEEKDV+KQQNMYAQLLPLAL Sbjct: 307 FAFPYLLQFIREYTGKVDELIKDKIEAQNEAKAKENEEKDVMKQQNMYAQLLPLAL 362 >gb|EYU26805.1| hypothetical protein MIMGU_mgv1a000127mg [Mimulus guttatus] Length = 1709 Score = 102 bits (254), Expect = 7e-20 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA+KE KAK+NEEKDV+ QQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELIKDKIEAVKEVKAKENEEKDVMMQQNMYAQLLPLAL 1663 >ref|XP_004240929.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum] Length = 1701 Score = 101 bits (252), Expect = 1e-19 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDELIKDKIEA E KA++NEEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELIKDKIEAQSEAKARENEEKDVMKQQNMYAQLLPLAL 1663 >ref|XP_006338824.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum] Length = 1701 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDEL+KDKIEA E KA++NEEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELVKDKIEAQSEAKARENEEKDVMKQQNMYAQLLPLAL 1663 >ref|XP_002276855.1| PREDICTED: clathrin heavy chain 2 [Vitis vinifera] gi|297745873|emb|CBI15929.3| unnamed protein product [Vitis vinifera] Length = 1705 Score = 101 bits (251), Expect = 2e-19 Identities = 47/56 (83%), Positives = 54/56 (96%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVD+L+KD+IEA+KE KAK+ EEKDV+KQQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDDLVKDRIEALKETKAKEEEEKDVVKQQNMYAQLLPLAL 1663 >gb|AAG50828.1|AC074395_2 clathrin heavy chain, putative [Arabidopsis thaliana] Length = 1516 Score = 100 bits (250), Expect = 2e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDVI QQNMYAQ+LPLAL Sbjct: 1421 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLAL 1476 >ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana] gi|122223626|sp|Q0WLB5.1|CLAH2_ARATH RecName: Full=Clathrin heavy chain 2 gi|110740394|dbj|BAF02092.1| hypothetical protein [Arabidopsis thaliana] gi|332641123|gb|AEE74644.1| Clathrin, heavy chain [Arabidopsis thaliana] Length = 1703 Score = 100 bits (250), Expect = 2e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDVI QQNMYAQ+LPLAL Sbjct: 1608 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLAL 1663 >dbj|BAD94884.1| hypothetical protein [Arabidopsis thaliana] Length = 152 Score = 100 bits (250), Expect = 2e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDVI QQNMYAQ+LPLAL Sbjct: 57 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLAL 112 >gb|AAM19776.1| AT3g08530/T8G24_1 [Arabidopsis thaliana] gi|21928019|gb|AAM78038.1| AT3g08530/T8G24_1 [Arabidopsis thaliana] Length = 694 Score = 100 bits (250), Expect = 2e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDVI QQNMYAQ+LPLAL Sbjct: 599 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLAL 654 >gb|AAF01510.1|AC009991_6 putative clathrin heavy chain [Arabidopsis thaliana] gi|12321871|gb|AAG50967.1|AC073395_9 clathrin heavy chain, putative; 28833-19741 [Arabidopsis thaliana] Length = 1705 Score = 100 bits (249), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDV+ QQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLAL 1663 >ref|NP_187724.2| Clathrin, heavy chain [Arabidopsis thaliana] gi|122223702|sp|Q0WNJ6.1|CLAH1_ARATH RecName: Full=Clathrin heavy chain 1 gi|110738758|dbj|BAF01303.1| hypothetical protein [Arabidopsis thaliana] gi|332641484|gb|AEE75005.1| Clathrin, heavy chain [Arabidopsis thaliana] Length = 1705 Score = 100 bits (249), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDV+ QQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLAL 1663 >ref|XP_002884831.1| hypothetical protein ARALYDRAFT_478454 [Arabidopsis lyrata subsp. lyrata] gi|297330671|gb|EFH61090.1| hypothetical protein ARALYDRAFT_478454 [Arabidopsis lyrata subsp. lyrata] Length = 1702 Score = 100 bits (249), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDV+ QQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLAL 1663 >ref|XP_002884683.1| hypothetical protein ARALYDRAFT_896987 [Arabidopsis lyrata subsp. lyrata] gi|297330523|gb|EFH60942.1| hypothetical protein ARALYDRAFT_896987 [Arabidopsis lyrata subsp. lyrata] Length = 1703 Score = 100 bits (249), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREYSGKVDELIKDK+EA KE KAK+ EEKDV+ QQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLAL 1663 >ref|XP_002528311.1| clathrin heavy chain, putative [Ricinus communis] gi|223532266|gb|EEF34069.1| clathrin heavy chain, putative [Ricinus communis] Length = 1705 Score = 100 bits (249), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -3 Query: 569 FAFPYLLQFIREYSGKVDELIKDKIEAMKEEKAKQNEEKDVIKQQNMYAQLLPLAL 402 FAFPYLLQFIREY+GKVDEL+KDKIEA KE KAK+ EEKDVI QQNMYAQLLPLAL Sbjct: 1608 FAFPYLLQFIREYTGKVDELVKDKIEAQKEVKAKEQEEKDVIAQQNMYAQLLPLAL 1663