BLASTX nr result
ID: Mentha28_contig00012295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00012295 (781 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN94266.1| leucine-rich repeat protein [Solenostemon scutell... 67 6e-09 gb|EYU35664.1| hypothetical protein MIMGU_mgv1a013556mg [Mimulus... 65 2e-08 ref|XP_006832864.1| hypothetical protein AMTR_s00095p00075330 [A... 65 3e-08 ref|XP_007016687.1| Leucine-rich repeat (LRR) family protein iso... 65 3e-08 ref|XP_007016686.1| Leucine-rich repeat family protein isoform 1... 65 3e-08 ref|XP_007205892.1| hypothetical protein PRUPE_ppa011333mg [Prun... 65 3e-08 ref|XP_004144110.1| PREDICTED: somatic embryogenesis receptor ki... 65 3e-08 emb|CBI32849.3| unnamed protein product [Vitis vinifera] 65 3e-08 ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor ki... 65 3e-08 ref|XP_002299783.1| hypothetical protein POPTR_0001s22700g [Popu... 65 3e-08 ref|XP_006400679.1| hypothetical protein EUTSA_v10014631mg [Eutr... 65 4e-08 ref|XP_006288424.1| hypothetical protein CARUB_v10001683mg, part... 65 4e-08 ref|NP_197608.1| leucine-rich repeat-containing protein [Arabido... 65 4e-08 gb|ABK24062.1| unknown [Picea sitchensis] 65 4e-08 gb|ABK21187.1| unknown [Picea sitchensis] gi|224285665|gb|ACN405... 65 4e-08 ref|XP_002275877.1| PREDICTED: somatic embryogenesis receptor ki... 65 4e-08 gb|EPS68473.1| hypothetical protein M569_06294, partial [Genlise... 64 5e-08 gb|ADO51751.1| leucine rich repeat protein [Camellia sinensis] 64 5e-08 gb|AAR83872.1| induced stolon tip protein LRP [Capsicum annuum] 64 5e-08 ref|XP_006470435.1| PREDICTED: somatic embryogenesis receptor ki... 64 6e-08 >gb|ACN94266.1| leucine-rich repeat protein [Solenostemon scutellarioides] Length = 218 Score = 67.4 bits (163), Expect = 6e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDPNLVNPCTWFHITCNQDNRVTRV Sbjct: 49 QSWDPNLVNPCTWFHITCNQDNRVTRV 75 >gb|EYU35664.1| hypothetical protein MIMGU_mgv1a013556mg [Mimulus guttatus] Length = 217 Score = 65.5 bits (158), Expect = 2e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDPNLVNPCTWFHITCNQDN VTRV Sbjct: 48 QSWDPNLVNPCTWFHITCNQDNHVTRV 74 >ref|XP_006832864.1| hypothetical protein AMTR_s00095p00075330 [Amborella trichopoda] gi|548837364|gb|ERM98142.1| hypothetical protein AMTR_s00095p00075330 [Amborella trichopoda] Length = 209 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTRV Sbjct: 41 QSWDPTLVNPCTWFHITCNQDNRVTRV 67 >ref|XP_007016687.1| Leucine-rich repeat (LRR) family protein isoform 2 [Theobroma cacao] gi|508787050|gb|EOY34306.1| Leucine-rich repeat (LRR) family protein isoform 2 [Theobroma cacao] Length = 213 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTRV Sbjct: 44 QSWDPTLVNPCTWFHITCNQDNRVTRV 70 >ref|XP_007016686.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao] gi|508787049|gb|EOY34305.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao] Length = 258 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTRV Sbjct: 89 QSWDPTLVNPCTWFHITCNQDNRVTRV 115 >ref|XP_007205892.1| hypothetical protein PRUPE_ppa011333mg [Prunus persica] gi|462401534|gb|EMJ07091.1| hypothetical protein PRUPE_ppa011333mg [Prunus persica] Length = 215 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTRV Sbjct: 46 QSWDPTLVNPCTWFHITCNQDNRVTRV 72 >ref|XP_004144110.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cucumis sativus] gi|449530873|ref|XP_004172416.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cucumis sativus] Length = 220 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTRV Sbjct: 51 QSWDPTLVNPCTWFHITCNQDNRVTRV 77 >emb|CBI32849.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDPNLVNPCTWFHITCNQD RVTRV Sbjct: 133 QSWDPNLVNPCTWFHITCNQDGRVTRV 159 >ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Vitis vinifera] Length = 218 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDPNLVNPCTWFHITCNQD RVTRV Sbjct: 49 QSWDPNLVNPCTWFHITCNQDGRVTRV 75 >ref|XP_002299783.1| hypothetical protein POPTR_0001s22700g [Populus trichocarpa] gi|222847041|gb|EEE84588.1| hypothetical protein POPTR_0001s22700g [Populus trichocarpa] Length = 215 Score = 65.1 bits (157), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTRV Sbjct: 46 QSWDPTLVNPCTWFHITCNQDNRVTRV 72 >ref|XP_006400679.1| hypothetical protein EUTSA_v10014631mg [Eutrema salsugineum] gi|557101769|gb|ESQ42132.1| hypothetical protein EUTSA_v10014631mg [Eutrema salsugineum] Length = 218 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFH+TCNQDNRVTRV Sbjct: 49 QSWDPTLVNPCTWFHVTCNQDNRVTRV 75 >ref|XP_006288424.1| hypothetical protein CARUB_v10001683mg, partial [Capsella rubella] gi|482557130|gb|EOA21322.1| hypothetical protein CARUB_v10001683mg, partial [Capsella rubella] Length = 275 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFH+TCNQDNRVTRV Sbjct: 106 QSWDPTLVNPCTWFHVTCNQDNRVTRV 132 >ref|NP_197608.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|11762126|gb|AAG40341.1|AF324989_1 AT5g21090 [Arabidopsis thaliana] gi|13899097|gb|AAK48970.1|AF370543_1 Unknown protein [Arabidopsis thaliana] gi|20148427|gb|AAM10104.1| unknown protein [Arabidopsis thaliana] gi|27311823|gb|AAO00877.1| Unknown protein [Arabidopsis thaliana] gi|29294060|gb|AAO73897.1| leucine rich repeat protein (LRP), putative [Arabidopsis thaliana] gi|30023686|gb|AAP13376.1| At5g21090 [Arabidopsis thaliana] gi|222424256|dbj|BAH20085.1| AT5G21090 [Arabidopsis thaliana] gi|332005547|gb|AED92930.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 218 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFH+TCNQDNRVTRV Sbjct: 49 QSWDPTLVNPCTWFHVTCNQDNRVTRV 75 >gb|ABK24062.1| unknown [Picea sitchensis] Length = 216 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTR+ Sbjct: 48 QSWDPTLVNPCTWFHITCNQDNRVTRI 74 >gb|ABK21187.1| unknown [Picea sitchensis] gi|224285665|gb|ACN40548.1| unknown [Picea sitchensis] Length = 216 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTR+ Sbjct: 48 QSWDPTLVNPCTWFHITCNQDNRVTRI 74 >ref|XP_002275877.1| PREDICTED: somatic embryogenesis receptor kinase 1 isoform 1 [Vitis vinifera] gi|359479201|ref|XP_003632232.1| PREDICTED: somatic embryogenesis receptor kinase 1 isoform 2 [Vitis vinifera] gi|296083993|emb|CBI24381.3| unnamed protein product [Vitis vinifera] Length = 214 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFH+TCNQDNRVTRV Sbjct: 46 QSWDPTLVNPCTWFHVTCNQDNRVTRV 72 >gb|EPS68473.1| hypothetical protein M569_06294, partial [Genlisea aurea] Length = 192 Score = 64.3 bits (155), Expect = 5e-08 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 +SWDPNLVNPCTWFH+TCNQDNRVTR+ Sbjct: 23 RSWDPNLVNPCTWFHVTCNQDNRVTRL 49 >gb|ADO51751.1| leucine rich repeat protein [Camellia sinensis] Length = 254 Score = 64.3 bits (155), Expect = 5e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDPNLVNPCTWFHITCNQ NRVTRV Sbjct: 85 QSWDPNLVNPCTWFHITCNQANRVTRV 111 >gb|AAR83872.1| induced stolon tip protein LRP [Capsicum annuum] Length = 101 Score = 64.3 bits (155), Expect = 5e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRVYAY 92 QSWDPNLVNPCTWFH+TCN DN+VTRV+ + Sbjct: 52 QSWDPNLVNPCTWFHVTCNGDNQVTRVFEH 81 >ref|XP_006470435.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Citrus sinensis] Length = 231 Score = 63.9 bits (154), Expect = 6e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 QSWDPNLVNPCTWFHITCNQDNRVTRV 83 QSWDP LVNPCTWFHITCNQDNRVTR+ Sbjct: 62 QSWDPTLVNPCTWFHITCNQDNRVTRL 88