BLASTX nr result
ID: Mentha28_contig00011865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00011865 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21928.1| hypothetical protein MIMGU_mgv1a007997mg [Mimulus... 103 2e-20 >gb|EYU21928.1| hypothetical protein MIMGU_mgv1a007997mg [Mimulus guttatus] Length = 388 Score = 103 bits (257), Expect = 2e-20 Identities = 51/68 (75%), Positives = 54/68 (79%), Gaps = 1/68 (1%) Frame = -2 Query: 201 MEGSRVIADNADGAAENCSSGDGRPPIPSSLGGRGAYRHCLVSGGTPP-LSAKSLVRHSS 25 MEGSRVI DN D ENCSSGDGRPPIP+SLGGR YRHCL S G PP L KSLVRHSS Sbjct: 1 MEGSRVIIDNGDAGRENCSSGDGRPPIPNSLGGRTVYRHCLNSDGAPPSLCTKSLVRHSS 60 Query: 24 LIKSRASD 1 L+K R+SD Sbjct: 61 LVKIRSSD 68