BLASTX nr result
ID: Mentha28_contig00011298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00011298 (880 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30284.1| hypothetical protein MIMGU_mgv1a000542mg [Mimulus... 57 9e-06 >gb|EYU30284.1| hypothetical protein MIMGU_mgv1a000542mg [Mimulus guttatus] Length = 1085 Score = 57.0 bits (136), Expect = 9e-06 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -3 Query: 782 CVSSIFDLAMQCVAFSPEERINMIEVVASLQKIKSKV 672 C+S +F LAM+C+AFSP ERI+M+E+VA+L KIK+KV Sbjct: 1046 CISCVFHLAMKCLAFSPHERIDMVEIVAALHKIKAKV 1082