BLASTX nr result
ID: Mentha28_contig00011213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00011213 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40299.1| hypothetical protein MIMGU_mgv1a005192mg [Mimulus... 80 2e-13 gb|EYU40298.1| hypothetical protein MIMGU_mgv1a005192mg [Mimulus... 80 2e-13 ref|XP_006354609.1| PREDICTED: probable serine/threonine-protein... 70 4e-10 ref|XP_004229508.1| PREDICTED: probable serine/threonine-protein... 68 1e-09 gb|EPS71043.1| hypothetical protein M569_03708 [Genlisea aurea] 62 1e-07 >gb|EYU40299.1| hypothetical protein MIMGU_mgv1a005192mg [Mimulus guttatus] Length = 412 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 264 MGCFQSKTANVQSPDQEPSHPDSKPDLANGDQVDPEQVPA 383 MGCFQSKTANVQSPDQ+PS PDSKPDLANG+QVDP+QVPA Sbjct: 1 MGCFQSKTANVQSPDQDPSLPDSKPDLANGEQVDPDQVPA 40 >gb|EYU40298.1| hypothetical protein MIMGU_mgv1a005192mg [Mimulus guttatus] Length = 493 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 264 MGCFQSKTANVQSPDQEPSHPDSKPDLANGDQVDPEQVPA 383 MGCFQSKTANVQSPDQ+PS PDSKPDLANG+QVDP+QVPA Sbjct: 1 MGCFQSKTANVQSPDQDPSLPDSKPDLANGEQVDPDQVPA 40 >ref|XP_006354609.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like [Solanum tuberosum] Length = 492 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 264 MGCFQSKTANVQSPDQEPSHPDSKPDLANGDQVDPEQVPA 383 MGC QSKT NVQSPD+EPS DSK DLANGDQVD +QVPA Sbjct: 1 MGCLQSKTVNVQSPDKEPSQDDSKTDLANGDQVDQDQVPA 40 >ref|XP_004229508.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like [Solanum lycopersicum] Length = 492 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +3 Query: 264 MGCFQSKTANVQSPDQEPSHPDSKPDLANGDQVDPEQVP 380 MGC QSKT NVQSPD+EPS DSK DLANGDQVD +QVP Sbjct: 1 MGCLQSKTVNVQSPDKEPSQDDSKTDLANGDQVDQDQVP 39 >gb|EPS71043.1| hypothetical protein M569_03708 [Genlisea aurea] Length = 496 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/40 (72%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 264 MGCFQSKTANVQSPDQEPSHPDSKPDLAN-GDQVDPEQVP 380 MGCFQSKTANVQSPD EP PD KPDL N G+ VD + VP Sbjct: 1 MGCFQSKTANVQSPDLEPPQPDQKPDLVNGGEAVDQDHVP 40