BLASTX nr result
ID: Mentha28_contig00011192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00011192 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021610.1| Transcription elongation factor 1 isoform 1 ... 65 1e-08 gb|EMS46056.1| hypothetical protein TRIUR3_02755 [Triticum urart... 64 2e-08 ref|XP_006449429.1| hypothetical protein CICLE_v10017311mg [Citr... 64 2e-08 ref|XP_006657996.1| PREDICTED: transcription elongation factor 1... 64 3e-08 gb|EXB39509.1| hypothetical protein L484_011426 [Morus notabilis] 63 4e-08 ref|XP_006467708.1| PREDICTED: transcription elongation factor 1... 63 4e-08 gb|EMT07146.1| hypothetical protein F775_30207 [Aegilops tauschii] 63 4e-08 ref|XP_003564321.1| PREDICTED: transcription elongation factor 1... 63 4e-08 ref|XP_004248129.1| PREDICTED: transcription elongation factor 1... 63 5e-08 ref|NP_001060360.1| Os07g0631100 [Oryza sativa Japonica Group] g... 62 6e-08 ref|XP_002522506.1| Transcription elongation factor, putative [R... 62 6e-08 ref|XP_007212318.1| hypothetical protein PRUPE_ppa014081mg [Prun... 62 8e-08 ref|XP_003633044.1| PREDICTED: transcription elongation factor 1... 62 8e-08 emb|CBI30630.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002277951.1| PREDICTED: transcription elongation factor 1... 62 8e-08 gb|ABK92767.1| unknown [Populus trichocarpa] gi|118489754|gb|ABK... 62 8e-08 ref|XP_006646844.1| PREDICTED: transcription elongation factor 1... 61 1e-07 ref|XP_007212303.1| hypothetical protein PRUPE_ppa014035mg [Prun... 61 1e-07 gb|EPS63964.1| hypothetical protein M569_10817 [Genlisea aurea] 60 2e-07 ref|NP_568654.1| transcription elongation factor 1-like protein ... 60 2e-07 >ref|XP_007021610.1| Transcription elongation factor 1 isoform 1 [Theobroma cacao] gi|508721238|gb|EOY13135.1| Transcription elongation factor 1 isoform 1 [Theobroma cacao] Length = 88 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 ESFSTTI ALTEPID+YSEWIDECERVN ED++A Sbjct: 54 ESFSTTITALTEPIDIYSEWIDECERVNNYEDDDA 88 >gb|EMS46056.1| hypothetical protein TRIUR3_02755 [Triticum urartu] gi|475539244|gb|EMT09364.1| hypothetical protein F775_28085 [Aegilops tauschii] Length = 89 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 ESFSTT++ALTEPID+YSEWIDECERVN ED++ Sbjct: 54 ESFSTTVNALTEPIDIYSEWIDECERVNTVEDDD 87 >ref|XP_006449429.1| hypothetical protein CICLE_v10017311mg [Citrus clementina] gi|567914233|ref|XP_006449430.1| hypothetical protein CICLE_v10017311mg [Citrus clementina] gi|567914235|ref|XP_006449431.1| hypothetical protein CICLE_v10017311mg [Citrus clementina] gi|557552040|gb|ESR62669.1| hypothetical protein CICLE_v10017311mg [Citrus clementina] gi|557552041|gb|ESR62670.1| hypothetical protein CICLE_v10017311mg [Citrus clementina] gi|557552042|gb|ESR62671.1| hypothetical protein CICLE_v10017311mg [Citrus clementina] Length = 92 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 ESFSTTI ALTEPID+YSEWIDECERVN ED+ A Sbjct: 54 ESFSTTITALTEPIDIYSEWIDECERVNNLEDDSA 88 >ref|XP_006657996.1| PREDICTED: transcription elongation factor 1 homolog [Oryza brachyantha] Length = 89 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 E+FSTT++ALTEPID+YSEWIDECERVN EDE+ Sbjct: 54 ENFSTTVNALTEPIDIYSEWIDECERVNNVEDED 87 >gb|EXB39509.1| hypothetical protein L484_011426 [Morus notabilis] Length = 88 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 ESFSTTI ALTEPID+YSEWIDECERVN ED+ A Sbjct: 54 ESFSTTITALTEPIDIYSEWIDECERVNNLEDDGA 88 >ref|XP_006467708.1| PREDICTED: transcription elongation factor 1 homolog isoform X1 [Citrus sinensis] gi|568826702|ref|XP_006467709.1| PREDICTED: transcription elongation factor 1 homolog isoform X2 [Citrus sinensis] Length = 92 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 ESFSTTI ALTEPID+YSEWIDECERVN ED+ A Sbjct: 54 ESFSTTITALTEPIDIYSEWIDECERVNNLEDDGA 88 >gb|EMT07146.1| hypothetical protein F775_30207 [Aegilops tauschii] Length = 117 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 ESFSTT +ALTEPIDVYSEWIDECERVN ED++ Sbjct: 82 ESFSTTANALTEPIDVYSEWIDECERVNTVEDDD 115 >ref|XP_003564321.1| PREDICTED: transcription elongation factor 1 homolog isoform 1 [Brachypodium distachyon] gi|357125278|ref|XP_003564322.1| PREDICTED: transcription elongation factor 1 homolog isoform 2 [Brachypodium distachyon] Length = 89 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 E+FSTT++ALTEPID+YSEWIDECERVN ED++ Sbjct: 54 ENFSTTVNALTEPIDIYSEWIDECERVNTVEDDD 87 >ref|XP_004248129.1| PREDICTED: transcription elongation factor 1 homolog isoform 1 [Solanum lycopersicum] gi|460405332|ref|XP_004248130.1| PREDICTED: transcription elongation factor 1 homolog isoform 2 [Solanum lycopersicum] gi|565390648|ref|XP_006361048.1| PREDICTED: transcription elongation factor 1 homolog isoform X1 [Solanum tuberosum] gi|565390650|ref|XP_006361049.1| PREDICTED: transcription elongation factor 1 homolog isoform X2 [Solanum tuberosum] Length = 92 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 ESFSTT+ ALTEPID+YSEWIDECERVN E+E+ Sbjct: 54 ESFSTTVTALTEPIDIYSEWIDECERVNNYEEED 87 >ref|NP_001060360.1| Os07g0631100 [Oryza sativa Japonica Group] gi|25453308|sp|Q8LHP0.1|ELOF1_ORYSJ RecName: Full=Transcription elongation factor 1 homolog gi|22296365|dbj|BAC10134.1| unknown protein [Oryza sativa Japonica Group] gi|113611896|dbj|BAF22274.1| Os07g0631100 [Oryza sativa Japonica Group] gi|125538787|gb|EAY85182.1| hypothetical protein OsI_06540 [Oryza sativa Indica Group] gi|125601184|gb|EAZ40760.1| hypothetical protein OsJ_25233 [Oryza sativa Japonica Group] Length = 89 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 E+FSTT++ALTEPID+YSEWIDECERVN ED++ Sbjct: 54 ENFSTTVNALTEPIDIYSEWIDECERVNNVEDDD 87 >ref|XP_002522506.1| Transcription elongation factor, putative [Ricinus communis] gi|223538197|gb|EEF39806.1| Transcription elongation factor, putative [Ricinus communis] Length = 88 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 ESFSTTI ALTEPIDVYSEWIDECERVN +D+ A Sbjct: 54 ESFSTTITALTEPIDVYSEWIDECERVNNVDDDGA 88 >ref|XP_007212318.1| hypothetical protein PRUPE_ppa014081mg [Prunus persica] gi|595880917|ref|XP_007212319.1| hypothetical protein PRUPE_ppa014081mg [Prunus persica] gi|462408183|gb|EMJ13517.1| hypothetical protein PRUPE_ppa014081mg [Prunus persica] gi|462408184|gb|EMJ13518.1| hypothetical protein PRUPE_ppa014081mg [Prunus persica] Length = 88 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 E+FSTTI ALTEPIDVYSEWIDECERVN +D+ A Sbjct: 54 ENFSTTITALTEPIDVYSEWIDECERVNTVDDDGA 88 >ref|XP_003633044.1| PREDICTED: transcription elongation factor 1 homolog isoform 2 [Vitis vinifera] Length = 83 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDE 209 ESFSTT+ ALTEPID+YSEWIDECERVN ED+ Sbjct: 42 ESFSTTVTALTEPIDIYSEWIDECERVNNLEDD 74 >emb|CBI30630.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDE 209 ESFSTT+ ALTEPID+YSEWIDECERVN ED+ Sbjct: 87 ESFSTTVTALTEPIDIYSEWIDECERVNNLEDD 119 >ref|XP_002277951.1| PREDICTED: transcription elongation factor 1 homolog isoform 1 [Vitis vinifera] Length = 95 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDE 209 ESFSTT+ ALTEPID+YSEWIDECERVN ED+ Sbjct: 54 ESFSTTVTALTEPIDIYSEWIDECERVNNLEDD 86 >gb|ABK92767.1| unknown [Populus trichocarpa] gi|118489754|gb|ABK96677.1| unknown [Populus trichocarpa x Populus deltoides] Length = 88 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEEA 203 ESFS TI ALTEPID+YSEWIDECERVN+ ED+ A Sbjct: 54 ESFSMTITALTEPIDIYSEWIDECERVNSLEDDGA 88 >ref|XP_006646844.1| PREDICTED: transcription elongation factor 1 homolog [Oryza brachyantha] Length = 110 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDE 209 ESFSTT++ALTEPID+YSEWIDECERVN E++ Sbjct: 54 ESFSTTVNALTEPIDIYSEWIDECERVNNLEED 86 >ref|XP_007212303.1| hypothetical protein PRUPE_ppa014035mg [Prunus persica] gi|462408168|gb|EMJ13502.1| hypothetical protein PRUPE_ppa014035mg [Prunus persica] Length = 90 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDE 209 ESFSTTI AL+EPIDVYSEWIDECERVN ED+ Sbjct: 54 ESFSTTITALSEPIDVYSEWIDECERVNNLEDD 86 >gb|EPS63964.1| hypothetical protein M569_10817 [Genlisea aurea] Length = 89 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDEE 206 ESFSTT+ +LTEPID+YSEWIDECERVN +++++ Sbjct: 54 ESFSTTVTSLTEPIDIYSEWIDECERVNNEDEDD 87 >ref|NP_568654.1| transcription elongation factor 1-like protein [Arabidopsis thaliana] gi|25453307|sp|Q8LEF3.1|ELOF1_ARATH RecName: Full=Transcription elongation factor 1 homolog gi|21553585|gb|AAM62678.1| unknown [Arabidopsis thaliana] gi|25082953|gb|AAN72021.1| putative protein [Arabidopsis thaliana] gi|30102810|gb|AAP21323.1| At5g46030 [Arabidopsis thaliana] gi|332007947|gb|AED95330.1| transcription elongation factor 1-like protein [Arabidopsis thaliana] Length = 120 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 307 ESFSTTIDALTEPIDVYSEWIDECERVNAQEDE 209 ESFSTTI ALTE ID+YSEWIDECERVN ED+ Sbjct: 54 ESFSTTITALTEAIDIYSEWIDECERVNTAEDD 86