BLASTX nr result
ID: Mentha28_contig00011029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00011029 (1199 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857548.1| hypothetical protein AMTR_s00061p00048280 [A... 58 7e-06 >ref|XP_006857548.1| hypothetical protein AMTR_s00061p00048280 [Amborella trichopoda] gi|548861644|gb|ERN19015.1| hypothetical protein AMTR_s00061p00048280 [Amborella trichopoda] Length = 270 Score = 58.2 bits (139), Expect = 7e-06 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -1 Query: 1115 SYVRALSVYILFIVACKYIPRENSLLRQVSSLLRGLPAIDSKKIQDDFLMVS 960 S +R L ++L + + IP ENSLLRQVSSLLR LPAI+S+K QDDFLMVS Sbjct: 215 SRIRILHQFLLAMQRGE-IPHENSLLRQVSSLLRRLPAIESEKFQDDFLMVS 265